Details of the Drug Therapeutic Target (DTT)
General Information of Drug Therapeutic Target (DTT) (ID: TTMS54D)
| DTT Name | Fragile histidine triad protein (FHIT) | ||||
|---|---|---|---|---|---|
| Synonyms | 
                                         
                        Fragile histidinetriad protein; Fragile histidinetriad (FHIT) gene; Dinucleosidetriphosphatase; Diadenosine 5',5'''-P1,P3-triphosphate hydrolase; Bis(5'-adenosyl)-triphosphatase; AP3AASE; AP3A hydrolase
                        
                     
                                     | 
            ||||
| Gene Name | FHIT | ||||
| DTT Type | 
                     Successful target 
                 | 
                [1] | |||
| BioChemical Class | 
                     Acid anhydride hydrolase 
                 | 
            ||||
| UniProt ID | |||||
| TTD ID | |||||
| 3D Structure | |||||
| EC Number | 
                     EC 3.6.1.29 
                 | 
            ||||
| Sequence | 
                                         
                        MSFRFGQHLIKPSVVFLKTELSFALVNRKPVVPGHVLVCPLRPVERFHDLRPDEVADLFQ 
                    
                TTQRVGTVVEKHFHGTSLTFSMQDGPEAGQTVKHVHVHVLPRKAGDFHRNDSIYEELQKH DKEDFPASWRSEEEMAAEAAALRVYFQ  | 
            ||||
| Function | 
                                         
                        Can also hydrolyze P(1)-P(4)-bis(5'-adenosyl) tetraphosphate (Ap4A), but has extremely low activity with ATP. Modulates transcriptional activation by CTNNB1 and thereby contributes to regulate the expression of genes essential for cell proliferation and survival, such as CCND1 and BIRC5. Plays a role in the induction of apoptosis via SRC and AKT1 signaling pathways. Inhibits MDM2-mediated proteasomal degradation of p53/TP53 and thereby plays a role in p53/TP53-mediated apoptosis. Induction of apoptosis depends on the ability of FHIT to bind P(1)-P(3)-bis(5'-adenosyl) triphosphate or related compounds, but does not require its catalytic activity, it may in part come from the mitochondrial form, which sensitizes the low-affinity Ca(2+) transporters, enhancing mitochondrial calcium uptake. Functions as tumor suppressor. Cleaves P(1)-P(3)-bis(5'-adenosyl) triphosphate (Ap3A) to yield AMP and ADP.
                        
                     
                                     | 
            ||||
| KEGG Pathway | |||||
Molecular Interaction Atlas (MIA) of This DTT
| Molecular Interaction Atlas (MIA) | ||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| 
                     1 Approved Drug(s) Targeting This DTT 
                                            
  | 
            ||||||||||||||||||||||||||||||||||
| 
                     2 Investigative Drug(s) Targeting This DTT 
                                            
  | 
            ||||||||||||||||||||||||||||||||||
The Drug-Metabolizing Enzyme (DME) Role of This DTT
| DTT DME Name | Dinucleosidetriphosphatase (FHIT) | |||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Gene Name | FHIT | |||||||||||||||||||||||||||
| 
                     1 Investigative Drug(s) Metabolized by This DTT 
                                            
  | 
            ||||||||||||||||||||||||||||
