Details of the Drug Therapeutic Target (DTT)
General Information of Drug Therapeutic Target (DTT) (ID: TTMVAIU)
DTT Name | Thymosin beta-4 (TMSB4X) | ||||
---|---|---|---|---|---|
Synonyms | TMSB4X; T beta-4; Fx | ||||
Gene Name | TMSB4X | ||||
DTT Type |
Literature-reported target
|
[1] | |||
BioChemical Class |
Thymosin family
|
||||
UniProt ID | |||||
TTD ID | |||||
3D Structure | |||||
Sequence |
MSDKPDMAEIEKFDKSKLKKTETQEKNPLPSKETIEQEKQAGES
|
||||
Function | Seraspenide inhibits the entry of hematopoietic pluripotent stem cellsinto the S-phase. | ||||
KEGG Pathway | |||||
Reactome Pathway | |||||