Details of the Drug Therapeutic Target (DTT)
General Information of Drug Therapeutic Target (DTT) (ID: TTN6GE9)
| DTT Name | Staphylococcus D-amino acid aminotransferase (Stap-coc dat) | ||||
|---|---|---|---|---|---|
| Synonyms | Stap-coc dat; DAAT; D-aspartate aminotransferase; D-amino acid transaminase; D-alanine aminotransferase | ||||
| Gene Name | Stap-coc dat | ||||
| DTT Type |
Literature-reported target
|
[1] | |||
| BioChemical Class |
Transaminase
|
||||
| UniProt ID | |||||
| TTD ID | |||||
| 3D Structure | |||||
| EC Number |
EC 2.6.1.21
|
||||
| Sequence |
MTKVFINGEFIDQNEAKVSYEDRGYVFGDGIYEYIRAYDGKLFTVTEHFERFIRSASEIQ
LDLGYTVEELIDVVRELLKVNNIQNGGIYIQATRGVAPRNHSFPTPEVKPVIMAFAKSYD RPYDDLENGINAATVEDIRWLRCDIKSLNLLGNVLAKEYAVKYNAGEAIQHRGETVTEGA SSNVYAIKDGAIYTHPVNNYILNGITRKVIKWISEDEDIPFKEETFTVEFLKNADEVIVS STSAEVTPVVKIDGEQVGDGKVGPVTRQLQEGFNKYIESRSS |
||||
| Function |
Acts on the D-isomers of alanine, leucine, aspartate, glutamate, aminobutyrate, norvaline and asparagine. The enzyme transfers an amino group from a substrate D-amino acid to the pyridoxal phosphate cofactor to form pyridoxamine andan alpha- keto acid in the first half-reaction. The second half-reaction is the reverse of the first, transferring the amino group from the pyridoxamine to a second alpha-keto acid to form the product D- amino acid via a ping-pong mechanism. This is an important process in the formation of D-alanine and D-glutamate, which are essential bacterial cell wall components.
|
||||
Molecular Interaction Atlas (MIA) of This DTT
| Molecular Interaction Atlas (MIA) | ||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
|
2 Investigative Drug(s) Targeting This DTT
|
||||||||||||||||||||||||||||||||||