Details of the Drug Therapeutic Target (DTT)
General Information of Drug Therapeutic Target (DTT) (ID: TTN7HMG)
DTT Name | Teratocarcinoma-derived growth factor 1 (TDGF1) | ||||
---|---|---|---|---|---|
Synonyms | TDGF1; Epidermal growth factor-like cripto protein CR1; Cripto-1 growth factor; Cripto; CRGF | ||||
Gene Name | TDGF1 | ||||
DTT Type |
Clinical trial target
|
[1] | |||
BioChemical Class |
Growth factor
|
||||
UniProt ID | |||||
TTD ID | |||||
3D Structure | |||||
Sequence |
MDCRKMARFSYSVIWIMAISKVFELGLVAGLGHQEFARPSRGYLAFRDDSIWPQEEPAIR
PRSSQRVPPMGIQHSKELNRTCCLNGGTCMLGSFCACPPSFYGRNCEHDVRKENCGSVPH DTWLPKKCSLCKCWHGQLRCFPQAFLPGCDGLVMDEHLVASRTPELPPSARTTTFMLVGI CLSIQSYY |
||||
Function | Could play a role in the determination of the epiblastic cells that subsequently give rise to the mesoderm. | ||||
Reactome Pathway | |||||
Molecular Interaction Atlas (MIA) of This DTT
Molecular Interaction Atlas (MIA) | ||||||||||||||||||||||||||||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
1 Clinical Trial Drug(s) Targeting This DTT
|
||||||||||||||||||||||||||||