Details of the Drug Therapeutic Target (DTT)

General Information of Drug Therapeutic Target (DTT) (ID: TTNAFOU)

DTT Name	Rotamase D (PPID)
Synonyms	Peptidylprolyl isomerase D; Peptidyl-prolyl cis-trans isomerase D; PPIase D; Cyclophilin-related protein; Cyclophilin-40; CYP40; CYP-40; 40 kDa peptidyl-prolyl cis-trans isomerase
Gene Name	PPID
DTT Type	Patented-recorded target	[1]
BioChemical Class	Cis-trans-isomerase
UniProt ID	PPID_HUMAN
TTD ID	T52447
3D Structure	Download 2D Sequence (FASTA) Download 3D Structure (PDB) Download
EC Number	EC 5.2.1.8
Sequence	MSHPSPQAKPSNPSNPRVFFDVDIGGERVGRIVLELFADIVPKTAENFRALCTGEKGIGH TTGKPLHFKGCPFHRIIKKFMIQGGDFSNQNGTGGESIYGEKFEDENFHYKHDREGLLSM ANAGRNTNGSQFFITTVPTPHLDGKHVVFGQVIKGIGVARILENVEVKGEKPAKLCVIAE CGELKEGDDGGIFPKDGSGDSHPDFPEDADIDLKDVDKILLITEDLKNIGNTFFKSQNWE MAIKKYAEVLRYVDSSKAVIETADRAKLQPIALSCVLNIGACKLKMSNWQGAIDSCLEAL ELDPSNTKALYRRAQGWQGLKEYDQALADLKKAQGIAPEDKAIQAELLKVKQKIKAQKDK EKAVYAKMFA
Function	Proposed to act as a co-chaperone in HSP90 complexes such as in unligated steroid receptors heterocomplexes. Different co-chaperones seem to compete for association with HSP90 thus establishing distinct HSP90-co-chaperone-receptor complexes with the potential to exert tissue-specific receptor activity control. May have a preference for estrogen receptor complexes and is not found in glucocorticoid receptor complexes. May be involved in cytoplasmic dynein-dependent movement of the receptor from the cytoplasm to the nucleus. May regulate MYB by inhibiting its DNA-binding activity. Involved in regulation of AHR signaling by promoting the formation of the AHR:ARNT dimer; the function is independent of HSP90 but requires the chaperone activity. Involved in regulation of UV radiation-induced apoptosis. Promotes cell viability in anaplastic lymphoma kinase-positive anaplastic large-cell lymphoma (ALK+ ALCL) cell lines. PPIase that catalyzes the cis-trans isomerization of proline imidic peptide bonds in oligopeptides and may therefore assist protein folding.
KEGG Pathway	Necroptosis (hsa04217 ) Cellular senescence (hsa04218 ) Alzheimer disease (hsa05010 ) Pathways of neurodegeneration - multiple diseases (hsa05022 ) Shigellosis (hsa05131 )
Reactome Pathway	ESR-mediated signaling (R-HSA-8939211 )

Molecular Interaction Atlas (MIA) of This DTT

Molecular Interaction Atlas (MIA)

MIA Detail

Jump to Detail Molecular Interaction Atlas of This DTT

3 Patented Agent(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
1313212-89-3	DMJRK9D	N. A.	N. A.	Patented	[2]
US8901295, F609	DMEAUJT	N. A.	N. A.	Patented	[2]
US8901295, F673	DMPICE1	N. A.	N. A.	Patented	[2]
------------------------------------------------------------------------------------

References

1	Cyclophilin D as a drug target. Curr Med Chem. 2003 Aug;10(16):1485-506.
2	Inhibitors of cyclophilins and uses thereof. US8901295.