Details of the Drug Therapeutic Target (DTT)

General Information of Drug Therapeutic Target (DTT) (ID: TTNDC4K)

• DTT Name: Ubiquitin-like protein Nedd8 (NEDD8)
• Synonyms: Neural precursor cell expressed developmentally down-regulated protein 8; Neddylin; NEDD-8
• Gene Name: NEDD8
• DTT Type: Clinical trial target; [1]
• BioChemical Class: Ubiquitin family
• UniProt ID: NEDD8_HUMAN
• TTD ID: T93995
• Sequence:
  MLIKVKTLTGKEIEIDIEPTDKVERIKERVEEKEGIPPQQQRLIYSGKQMNDEKTAADYK
  ILGGSVLHLVLALRGGGGLRQ
• Function: Ubiquitin-like protein which plays an important role in cell cycle control and embryogenesis. Covalent attachment to its substrates requires prior activation by the E1 complex UBE1C-APPBP1 and linkage to the E2 enzyme UBE2M. Attachment of NEDD8 to cullins activates their associated E3 ubiquitin ligase activity, and thus promotes polyubiquitination and proteasomal degradation of cyclins and other regulatory proteins.
• Reactome Pathway:
  UCH proteinases (R-HSA-5689603)
  Cargo recognition for clathrin-mediated endocytosis (R-HSA-8856825)
  Neddylation (R-HSA-8951664)
  Iron uptake and transport (R-HSA-917937)
  TGF-beta receptor signaling activates SMADs (R-HSA-2173789)

Molecular Interaction Atlas (MIA) of This DTT

1 Clinical Trial Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
MLN4924	DMP36KD	Myelodysplastic syndrome	2A37	Phase 3	[1]

References

• [1] Promoting tumorigenesis in nasopharyngeal carcinoma, NEDD8 serves as a potential theranostic target.Cell Death Dis. 2017 Jun 1;8(6):e2834.