Details of the Drug Therapeutic Target (DTT)
General Information of Drug Therapeutic Target (DTT) (ID: TTNFESW)
DTT Name | Glutamate--cysteine ligase modifier (GCLM) | ||||
---|---|---|---|---|---|
Synonyms | Glutamate--cysteine ligase modifier subunit; Gamma-glutamylcysteine synthetase regulatory subunit; Gamma-ECS regulatory subunit; GCS light chain | ||||
Gene Name | GCLM | ||||
DTT Type |
Literature-reported target
|
[1] | |||
BioChemical Class |
Aldo/keto reductase family
|
||||
UniProt ID | |||||
TTD ID | |||||
3D Structure | |||||
Sequence |
MGTDSRAAKALLARARTLHLQTGNLLNWGRLRKKCPSTHSEELHDCIQKTLNEWSSQINP
DLVREFPDVLECTVSHAVEKINPDEREEMKVSAKLFIVESNSSSSTRSAVDMACSVLGVA QLDSVIIASPPIEDGVNLSLEHLQPYWEELENLVQSKKIVAIGTSDLDKTQLEQLYQWAQ VKPNSNQVNLASCCVMPPDLTAFAKQFDIQLLTHNDPKELLSEASFQEALQESIPDIQAH EWVPLWLLRYSVIVKSRGIIKSKGYILQAKRRGS |
||||
Function |
cytosol, glutamate-cysteine ligase complex, enzyme regulator activity, glutamate-cysteine ligase catalytic subunit binding, glutamate metabolic process, glutathione biosynthetic process, positive regulation of glutamate-cysteine ligase activity, regulation of blood vessel size, response to drug, response to oxidative stress.
|
||||
KEGG Pathway | |||||
Molecular Interaction Atlas (MIA) of This DTT
Molecular Interaction Atlas (MIA) | ||||||||||||||||||||||||||||||||||||||||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
3 Investigative Drug(s) Targeting This DTT
|
||||||||||||||||||||||||||||||||||||||||
The Drug-Metabolizing Enzyme (DME) Role of This DTT
DTT DME Name | Glutamate-cysteine ligase regulatory (GCLM) | |||||||||||||||||||||||||||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Gene Name | GCLM | |||||||||||||||||||||||||||
1 Clinical Trial Drug(s) Metabolized by This DTT
|
||||||||||||||||||||||||||||
References