Details of the Drug Therapeutic Target (DTT)

General Information of Drug Therapeutic Target (DTT) (ID: TTNPEFX)

DTT Name	Fibroblast growth factor-10 (FGF10)
Synonyms	Fibroblast growth factor 10; FGF10
Gene Name	FGF10
DTT Type	Discontinued target	[1]
BioChemical Class	Growth factor
UniProt ID	FGF10_HUMAN
TTD ID	T62763
3D Structure	Download 2D Sequence (FASTA) Download 3D Structure (PDB) Download
Sequence	MWKWILTHCASAFPHLPGCCCCCFLLLFLVSSVPVTCQALGQDMVSPEATNSSSSSFSSP SSAGRHVRSYNHLQGDVRWRKLFSFTKYFLKIEKNGKVSGTKKENCPYSILEITSVEIGV VAVKAINSNYYLAMNKKGKLYGSKEFNNDCKLKERIEENGYNTYASFNWQHNGRQMYVAL NGKGAPRRGQKTRRKNTSAHFLPMVVHS
Function	Plays an important role in the regulation of embryonic development, cell proliferation and cell differentiation. Required for normal branching morphogenesis. May play a role in wound healing.
KEGG Pathway	MAPK signaling pathway (hsa04010 ) Ras signaling pathway (hsa04014 ) Rap1 signaling pathway (hsa04015 ) PI3K-Akt signaling pathway (hsa04151 ) Regulation of actin cytoskeleton (hsa04810 ) Pathways in cancer (hsa05200 ) Melanoma (hsa05218 )
Reactome Pathway	PIP3 activates AKT signaling (R-HSA-1257604 ) FGFR2b ligand binding and activation (R-HSA-190377 ) Activated point mutants of FGFR2 (R-HSA-2033519 ) Constitutive Signaling by Aberrant PI3K in Cancer (R-HSA-2219530 ) Phospholipase C-mediated cascade (R-HSA-5654219 ) Phospholipase C-mediated cascade (R-HSA-5654221 ) SHC-mediated cascade (R-HSA-5654688 ) PI-3K cascade (R-HSA-5654689 ) FRS-mediated FGFR1 signaling (R-HSA-5654693 ) PI-3K cascade (R-HSA-5654695 ) SHC-mediated cascade (R-HSA-5654699 ) FRS-mediated FGFR2 signaling (R-HSA-5654700 ) Negative regulation of FGFR1 signaling (R-HSA-5654726 ) Negative regulation of FGFR2 signaling (R-HSA-5654727 ) RAF/MAP kinase cascade (R-HSA-5673001 ) PI3K Cascade (R-HSA-109704 )

Molecular Interaction Atlas (MIA) of This DTT

Molecular Interaction Atlas (MIA)

MIA Detail

Jump to Detail Molecular Interaction Atlas of This DTT

1 Discontinued Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
Repifermin	DMSOALX	Oral mucositis	DA01.11	Discontinued in Phase 2	[1]
------------------------------------------------------------------------------------

References

1	Repifermin (keratinocyte growth factor-2) for the treatment of active ulcerative colitis: a randomized, double-blind, placebo-controlled, dose-escalation trial. Aliment Pharmacol Ther. 2003 Jun 1;17(11):1355-64.