Details of the Drug Therapeutic Target (DTT)

General Information of Drug Therapeutic Target (DTT) (ID: TTNT2S6)

• DTT Name: Fatty acid-binding protein 5 (FABP5)
• Synonyms: Psoriasis-associated fatty acid-binding protein homolog; PA-FABP; Fatty acid-binding protein, epidermal; Fatty Acid BindingProtein mal1; Epidermal-type fatty acid-binding protein; E-FABP
• Gene Name: FABP5
• DTT Type: Patented-recorded target; [1]
• BioChemical Class: Fatty acid binding protein
• UniProt ID: FABP5_HUMAN
• TTD ID: T21507
• Sequence:
  MATVQQLEGRWRLVDSKGFDEYMKELGVGIALRKMGAMAKPDCIITCDGKNLTIKTESTL
  KTTQFSCTLGEKFEETTADGRKTQTVCNFTDGALVQHQEWDGKESTITRKLKDGKLVVEC
  VMNNVTCTRIYEKVE
• Function: Intracellular carrier for long-chain fatty acids and related active lipids, such as the endocannabinoid, that regulates the metabolism and actions of the ligands they bind. In addition to the cytosolic transport, selectively delivers specific fatty acids from the cytosol to the nucleus, wherein they activate nuclear receptors. Delivers retinoic acid to the nuclear receptor peroxisome proliferator-activated receptor delta; which promotes proliferation and survival. May also serve as a synaptic carrier of endocannabinoid at central synapses and thus controls retrograde endocannabinoid signaling. Modulates inflammation by regulating PTGES induction via NF-kappa-B activation, and prostaglandin E2 (PGE2) biosynthesis during inflammation. May be involved in keratinocyte differentiation.
• KEGG Pathway: PPAR signaling pathway (hsa03320)
• Reactome Pathway: Hormone-sensitive lipase (HSL)-mediated triacylglycerol hydrolysis (R-HSA-163560)

Molecular Interaction Atlas (MIA) of This DTT

20 Patented Agent(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
PMID27109571-Compound-12	DM6HWBK	N. A.	N. A.	Patented	[1]
PMID27109571-Compound-13	DMUKOGJ	N. A.	N. A.	Patented	[1]
PMID27109571-Compound-14	DMVY6B9	N. A.	N. A.	Patented	[1]
PMID27109571-Compound-15	DMUR3FY	N. A.	N. A.	Patented	[1]
PMID27109571-Compound-16	DMZI25U	N. A.	N. A.	Patented	[1]
PMID27109571-Compound-17	DMBETU6	N. A.	N. A.	Patented	[1]
PMID27109571-Compound-18	DM4S5ME	N. A.	N. A.	Patented	[1]
PMID27109571-Compound-19	DMIJGLB	N. A.	N. A.	Patented	[1]
PMID27109571-Compound-20	DMQU9XP	N. A.	N. A.	Patented	[1]
PMID27109571-Compound-21	DM0R5Y8	N. A.	N. A.	Patented	[1]
PMID27109571-Compound-22	DMC52VP	N. A.	N. A.	Patented	[1]
PMID27109571-Compound-23	DML49UI	N. A.	N. A.	Patented	[1]
PMID27109571-Compound-24	DMPHTC0	N. A.	N. A.	Patented	[1]
PMID27109571-Compound-25	DM435GR	N. A.	N. A.	Patented	[1]
PMID27109571-Compound-26	DMJCL53	N. A.	N. A.	Patented	[1]
PMID27109571-Compound-27	DMXRTH4	N. A.	N. A.	Patented	[1]
PMID27109571-Compound-28	DMTZVY3	N. A.	N. A.	Patented	[1]
PMID27109571-Compound-29	DMDMEHQ	N. A.	N. A.	Patented	[1]
PMID27109571-Compound-30	DM24FSP	N. A.	N. A.	Patented	[1]
PMID27109571-Compound-31	DMU690T	N. A.	N. A.	Patented	[1]

6 Investigative Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
2-(2,3-bis(2-chlorobenzyloxy)phenyl)acetic acid	DM1T8IP	Discovery agent	N.A.	Investigative	[2]
2-(Carbazole-9-sulfonyl)-benzoic acid	DMA6P4J	Discovery agent	N.A.	Investigative	[3]
4-Carbazol-9-yl-butyric acid	DM74GWO	Discovery agent	N.A.	Investigative	[3]
5-Carbazol-9-yl-pentanoic acid	DM04WVH	Discovery agent	N.A.	Investigative	[3]
BMS-480404	DMTPNI4	Discovery agent	N.A.	Investigative	[2]
Hexadecanoic acid	DMWUXDZ	Discovery agent	N.A.	Investigative	[3]

References

• [1] Fatty acid binding protein (FABP) inhibitors: a patent review (2012-2015).Expert Opin Ther Pat. 2016 Jul;26(7):767-76.
• [2] NMR structure of a potent small molecule inhibitor bound to human keratinocyte fatty acid-binding protein. J Med Chem. 2006 Aug 10;49(16):5013-7.
• [3] Discovery of inhibitors of human adipocyte fatty acid-binding protein, a potential type 2 diabetes target. Bioorg Med Chem Lett. 2004 Sep 6;14(17):4445-8.