Details of the Drug Therapeutic Target (DTT)
General Information of Drug Therapeutic Target (DTT) (ID: TTNWOIT)
| DTT Name | Prostate-associated gene 5 protein (PAGE5) | ||||
|---|---|---|---|---|---|
| Synonyms | PAGE-5; P antigen family member 5; GAGEE1; G antigen family E member 1; Cancer/testis antigen 16.1; CT16.1 | ||||
| Gene Name | PAGE5 | ||||
| DTT Type |
Literature-reported target
|
[1] | |||
| UniProt ID | |||||
| TTD ID | |||||
| 3D Structure | |||||
| Sequence |
MQAPWAGNRGWAGTREEVRDMSEHVTRSQSSERGNDQESSQPVGPVIVQQPTEEKRQEEE
PPTDNQGIAPSGEIKNEGAPAVQGTDVEAFQQELALLKIEDAPGDGPDVREGTLPTFDPT KVLEAGEGQL |
||||
| Function |
A member of family of proteins that are expressed in a variety of tumors and in some fetal and reproductive tissues. The encoded protein may protect cells from programmed cell death. Multiple alternatively spliced transcript variants encoding distinct isoforms have been found.
|
||||