Details of the Drug Therapeutic Target (DTT)

General Information of Drug Therapeutic Target (DTT) (ID: TTNZMY2)

DTT Name	Interleukin-20 (IL20)
Synonyms	ZCYTO10; UNQ852/PRO1801; IL-20; Four alpha helix cytokine ZCYTO10; Cytokine Zcyto10
Gene Name	IL20
DTT Type	Clinical trial target	[1]
BioChemical Class	Cytokine: interleukin
UniProt ID	IL20_HUMAN
TTD ID	T94482
3D Structure	Download 2D Sequence (FASTA) Download 3D Structure (PDB) Download
Sequence	MKASSLAFSLLSAAFYLLWTPSTGLKTLNLGSCVIATNLQEIRNGFSEIRGSVQAKDGNI DIRILRRTESLQDTKPANRCCLLRHLLRLYLDRVFKNYQTPDHYTLRKISSLANSFLTIK KDLRLCHAHMTCHCGEEAMKKYSQILSHFEKLEPQAAVVKALGELDILLQWMEETE
Function	Angiogenic and proliferative activities are antagonized by IL10. May act through STAT3. Proinflammatory and angiogenic cytokine that may be involved in epidermal function and psoriasis.
KEGG Pathway	Cytokine-cytokine receptor interaction (hsa04060 ) Jak-STAT signaling pathway (hsa04630 )
Reactome Pathway	Interleukin-20 family signaling (R-HSA-8854691 )

Molecular Interaction Atlas (MIA) of This DTT

Molecular Interaction Atlas (MIA)

Jump to Detail Molecular Interaction Atlas of This DTT

1 Clinical Trial Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
NN-8226	DMKD5ZO	Psoriasis vulgaris	EA90	Phase 2	[1]
------------------------------------------------------------------------------------

Molecular Expression Atlas (MEA) of This DTT

Molecular Expression Atlas (MEA)

Jump to Detail Molecular Expression Atlas of This DTT

Disease Name	ICD 11	Studied Tissue	p-value	Fold-Change	Z-score
Psoriasis	EA90	Skin	1.82E-12	1.01	1.18
------------------------------------------------------------------------------------

References

1	Handbook of Therapeutic Antibodies. 2014. 1. Page(995).