Details of the Drug Therapeutic Target (DTT)

General Information of Drug Therapeutic Target (DTT) (ID: TTO3NYT)

• DTT Name: Galectin-1 (LGALS1)
• Synonyms: SLac lectin 1; S-Lac lectin 1; Putative MAPKactivating protein PM12; Putative MAPK-activating protein PM12; Lectin galactosidebinding soluble 1; Lectin galactoside-binding soluble 1; Lactosebinding lectin 1; Lactose-binding lectin 1; HPL; HLBP14; HBL; Galaptin; Gal1; Gal-1; Betagalactosidebinding lectin L14I; Beta-galactoside-binding lectin L-14-I; 14 kDa lectin; 14 kDa lamininbinding protein; 14 kDa laminin-binding protein
• Gene Name: LGALS1
• DTT Type: Patented-recorded target; [1]
• UniProt ID: LEG1_HUMAN
• TTD ID: T09544
• Sequence:
  MACGLVASNLNLKPGECLRVRGEVAPDAKSFVLNLGKDSNNLCLHFNPRFNAHGDANTIV
  CNSKDGGAWGTEQREAVFPFQPGSVAEVCITFDQANLTVKLPDGYEFKFPNRLNLEAINY
  MAADGDFKIKCVAFD
• Function: Plays a role in regulating apoptosis, cell proliferation and cell differentiation. Inhibits CD45 protein phosphatase activity and therefore the dephosphorylation of Lyn kinase. Strong inducer of T-cell apoptosis. Lectin that binds beta-galactoside and a wide array of complex carbohydrates.
• Reactome Pathway:
  Post-translational protein phosphorylation (R-HSA-8957275)
  Regulation of Insulin-like Growth Factor (IGF) transport and uptake by Insulin-like Growth Factor Binding Proteins (IGFBPs) (R-HSA-381426)

Molecular Interaction Atlas (MIA) of This DTT

3 Patented Agent(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
US8703720, 15	DMKYNB0	N. A.	N. A.	Patented	[2]
US8703720, Reference Compound 1	DMFGIPR	N. A.	N. A.	Patented	[2]
US8703720, Reference Compound 2	DM536FO	N. A.	N. A.	Patented	[2]

References

• [1] Human Galectin-1 and its inhibitors: Privileged target for cancer and HIV. Mini Rev Med Chem. 2019 Mar 4.
• [2] Galactoside inhibitors of galectins. US8703720.