Details of the Drug Therapeutic Target (DTT)
General Information of Drug Therapeutic Target (DTT) (ID: TTOBVIN)
DTT Name | Secretin receptor (SCT) | ||||
---|---|---|---|---|---|
Synonyms | SCTR; SCT-R; SCT | ||||
Gene Name | SCT | ||||
DTT Type |
Successful target
|
[1] | |||
BioChemical Class |
GPCR secretin
|
||||
UniProt ID | |||||
TTD ID | |||||
3D Structure | |||||
Sequence |
MAPRPLLLLLLLLGGSAARPAPPRARRHSDGTFTSELSRLREGARLQRLLQGLVGKRSEQ
DAENSMAWTRLSAGLLCPSGSNMPILQAWMPLDGTWSPWLPPGPMVSEPAGAAAEGTLRP R |
||||
Function | This is a receptor for secretin. The activity of this receptor is mediated by G proteins which activate adenylyl cyclase. | ||||
KEGG Pathway | |||||
Reactome Pathway | |||||
Molecular Interaction Atlas (MIA) of This DTT
Molecular Interaction Atlas (MIA) | ||||||||||||||||||||||||||||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
1 Approved Drug(s) Targeting This DTT
|
||||||||||||||||||||||||||||