Details of the Drug Therapeutic Target (DTT)
General Information of Drug Therapeutic Target (DTT) (ID: TTODWGT)
| DTT Name | RING-box protein 2 (RNF7) | ||||
|---|---|---|---|---|---|
| Synonyms | Sensitive to apoptosis gene protein; SAG; Regulator of cullins 2; Rbx2; ROC2; RING finger protein 7; CKII beta-binding protein 1; CKBBP1 | ||||
| Gene Name | RNF7 | ||||
| DTT Type |
Literature-reported target
|
[1] | |||
| BioChemical Class |
Zinc-finger
|
||||
| UniProt ID | |||||
| TTD ID | |||||
| 3D Structure | |||||
| Sequence |
MADVEDGEETCALASHSGSSGSKSGGDKMFSLKKWNAVAMWSWDVECDTCAICRVQVMDA
CLRCQAENKQEDCVVVWGECNHSFHNCCMSLWVKQNNRCPLCQQDWVVQRIGK |
||||
| Function |
CRLs complexes and ARIH1 collaborate in tandem to mediate ubiquitination of target proteins, ARIH1 mediating addition of the first ubiquitin on CRLs targets. Through the RING-type zinc finger, seems to recruit the E2 ubiquitination enzyme to the complex and brings it into close proximity to the substrate. Promotes the neddylation of CUL5 via its interaction with UBE2F. May play a role in protecting cells from apoptosis induced by redox agents. Probable component of the SCF (SKP1-CUL1-F-box protein) E3 ubiquitin ligase complex which mediates the ubiquitination and subsequent proteasomal degradation of target proteins involved in cell cycle progression, signal transduction and transcription.
|
||||
| KEGG Pathway | |||||
| Reactome Pathway | |||||