Details of the Drug Therapeutic Target (DTT)

General Information of Drug Therapeutic Target (DTT) (ID: TTOM5AU)

• DTT Name: c-Fos messenger RNA (c-Fos mRNA)
• Synonyms: Proto-oncogene c-Fos (mRNA); G0S7 (mRNA); G0/G1 switch regulatory protein 7 (mRNA); Cellular oncogene fos (mRNA); C-fos (mRNA)
• Gene Name: FOS
• DTT Type: Literature-reported target; [1]
• BioChemical Class: mRNA target
• UniProt ID: FOS_HUMAN
• TTD ID: T58495
• Sequence:
  MMFSGFNADYEASSSRCSSASPAGDSLSYYHSPADSFSSMGSPVNAQDFCTDLAVSSANF
  IPTVTAISTSPDLQWLVQPALVSSVAPSQTRAPHPFGVPAPSAGAYSRAGVVKTMTGGRA
  QSIGRRGKVEQLSPEEEEKRRIRRERNKMAAAKCRNRRRELTDTLQAETDQLEDEKSALQ
  TEIANLLKEKEKLEFILAAHRPACKIPDDLGFPEEMSVASLDLTGGLPEVATPESEEAFT
  LPLLNDPEPKPSVEPVKSISSMELKTEPFDDFLFPASSRPSGSETARSVPDMDLSGSFYA
  ADWEPLHSGSLGMGPMATELEPLCTPVVTCTPSCTAYTSSFVFTYPEADSFPSCAAAHRK
  GSSSNEPSSDSLSSPTLLAL
• Function: In the heterodimer, FOS and JUN/AP-1 basic regions each seems to interact with symmetrical DNA half sites. On TGF-beta activation, forms a multimeric SMAD3/SMAD4/JUN/FOS complex at the AP1/SMAD-binding site to regulate TGF-beta-mediated signaling. Has a critical function in regulating the development of cells destined to form and maintain the skeleton. It is thought to have an important role in signal transduction, cell proliferation and differentiation. In growing cells, activates phospholipid synthesis, possibly by activating CDS1 and PI4K2A. This activity requires Tyr-dephosphorylation and association with the endoplasmic reticulum. Nuclear phosphoprotein which forms a tight but non-covalently linked complex with the JUN/AP-1 transcription factor.
• KEGG Pathway:
  Endocrine resistance (hsa01522)
  MAPK signaling pathway (hsa04010)
  cAMP signaling pathway (hsa04024)
  Apoptosis (hsa04210)
  Osteoclast differentiation (hsa04380)
  Toll-like receptor signaling pathway (hsa04620)
  IL-17 signaling pathway (hsa04657)
  Th1 and Th2 cell differentiation (hsa04658)
  Th17 cell differentiation (hsa04659)
  T cell receptor signaling pathway (hsa04660)
  B cell receptor signaling pathway (hsa04662)
  TNF signaling pathway (hsa04668)
  Circadian entrainment (hsa04713)
  Cholinergic synapse (hsa04725)
  Dopaminergic synapse (hsa04728)
  Estrogen signaling pathway (hsa04915)
  Prolactin signaling pathway (hsa04917)
  Oxytocin signaling pathway (hsa04921)
  Relaxin signaling pathway (hsa04926)
  Parathyroid hormone synthesis, secretion and action (hsa04928)
  Non-alcoholic fatty liver disease (hsa04932)
  Growth hormone synthesis, secretion and action (hsa04935)
  Amphetamine addiction (hsa05031)
  Pathogenic Escherichia coli infection (hsa05130)
  Salmonella infection (hsa05132)
  Pertussis (hsa05133)
  Yersinia infection (hsa05135)
  Leishmaniasis (hsa05140)
  Chagas disease (hsa05142)
  Hepatitis B (hsa05161)
  Measles (hsa05162)
  Human T-cell leukemia virus 1 infection (hsa05166)
  Kaposi sarcoma-associated herpesvirus infection (hsa05167)
  Human immunodeficiency virus 1 infection (hsa05170)
  Coronavirus disease - COVID-19 (hsa05171)
  Pathways in cancer (hsa05200)
  Chemical carcinogenesis - receptor activation (hsa05207)
  Chemical carcinogenesis - reactive oxygen species (hsa05208)
  Colorectal cancer (hsa05210)
  Breast cancer (hsa05224)
  Choline metabolism in cancer (hsa05231)
  PD-L1 expression and PD-1 checkpoint pathway in cancer (hsa05235)
  Rheumatoid arthritis (hsa05323)
  Lipid and atherosclerosis (hsa05417)
  Fluid shear stress and atherosclerosis (hsa05418)
• Reactome Pathway:
  Senescence-Associated Secretory Phenotype (SASP) (R-HSA-2559582)
  FCERI mediated MAPK activation (R-HSA-2871796)
  Activation of the AP-1 family of transcription factors (R-HSA-450341)
  Interleukin-4 and Interleukin-13 signaling (R-HSA-6785807)
  TP53 Regulates Transcription of DNA Repair Genes (R-HSA-6796648)
  Estrogen-dependent gene expression (R-HSA-9018519)
  NGF-stimulated transcription (R-HSA-9031628)
  Estrogen-dependent nuclear events downstream of ESR-membrane signaling (R-HSA-9634638)
  Oxidative Stress Induced Senescence (R-HSA-2559580)

Molecular Interaction Atlas (MIA) of This DTT

1 Investigative Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
ISIS 10639	DM4YJQG	Discovery agent	N.A.	Investigative	[1]

References

• [1] US patent application no. 6,312,900, Antisense oligonucleotide compositions and methods for the modulation of activating protein 1.