Details of the Drug Therapeutic Target (DTT)
General Information of Drug Therapeutic Target (DTT) (ID: TTONPVW)
DTT Name | Uteroglobin (SCGB1A1) | ||||
---|---|---|---|---|---|
Synonyms | Urine protein 1; Urinary protein 1; UP-1; Secretoglobin family 1A member 1; SCGB1A1; Clara cells 10 kDa secretory protein; Clara cell phospholipid-binding protein; CCPBP; CC10 | ||||
Gene Name | SCGB1A1 | ||||
DTT Type |
Literature-reported target
|
[1] | |||
BioChemical Class |
Secretoglobin family
|
||||
UniProt ID | |||||
TTD ID | |||||
3D Structure | |||||
Sequence |
MKLAVTLTLVTLALCCSSASAEICPSFQRVIETLLMDTPSSYEAAMELFSPDQDMREAGA
QLKKLVDTLPQKPRESIIKLMEKIAQSSLCN |
||||
Function | Binds phosphatidylcholine, phosphatidylinositol, polychlorinated biphenyls (PCB) and weakly progesterone, potent inhibitor of phospholipase A2. | ||||