| DTT Name |
Proteasome beta-9 (PS beta-9)
|
| Synonyms |
Really interesting new gene 12 protein; RING12; Proteasome subunit beta-1i; Proteasome subunit beta type-9; Proteasome chain 7; PSMB6i; Multicatalytic endopeptidase complex chain 7; Macropain chain 7; Low molecular mass protein 2; LMP2
|
| Gene Name |
PSMB9
|
| DTT Type |
Patented-recorded target
|
[1] |
| BioChemical Class |
Peptidase
|
| UniProt ID |
|
| TTD ID |
|
| 3D Structure |
|
| EC Number |
EC 3.4.25.1
|
| Sequence |
MLRAGAPTGDLPRAGEVHTGTTIMAVEFDGGVVMGSDSRVSAGEAVVNRVFDKLSPLHER
IYCALSGSAADAQAVADMAAYQLELHGIELEEPPLVLAAANVVRNISYKYREDLSAHLMV
AGWDQREGGQVYGTLGGMLTRQPFAIGGSGSTFIYGYVDAAYKPGMSPEECRRFTTDAIA
LAMSRDGSSGGVIYLVTITAAGVDHRVILGNELPKFYDE
|
| Function |
The proteasome has an ATP-dependent proteolytic activity. This subunit is involved in antigen processing to generate class I binding peptides. Replacement of PSMB6 by PSMB9 increases the capacity of the immunoproteasome to cleave model peptides after hydrophobic and basic residues. The proteasome is a multicatalytic proteinase complex which is characterized by its ability to cleave peptides with Arg, Phe, Tyr, Leu, and Glu adjacent to the leaving group at neutral or slightly basic pH.
|
| KEGG Pathway |
- Proteasome (hsa03050 )
|
| Reactome Pathway |
- Oxygen-dependent proline hydroxylation of Hypoxia-inducible Factor Alpha (R-HSA-1234176 )
- ER-Phagosome pathway (R-HSA-1236974 )
- Cross-presentation of soluble exogenous antigens (endosomes) (R-HSA-1236978 )
- Autodegradation of Cdh1 by Cdh1 (R-HSA-174084 )
- SCF-beta-TrCP mediated degradation of Emi1 (R-HSA-174113 )
- APC/C (R-HSA-174154 )
- APC/C (R-HSA-174178 )
- Cdc20 (R-HSA-174184 )
- Vpu mediated degradation of CD4 (R-HSA-180534 )
- Vif-mediated degradation of APOBEC3G (R-HSA-180585 )
- SCF(Skp2)-mediated degradation of p27/p21 (R-HSA-187577 )
- Degradation of beta-catenin by the destruction complex (R-HSA-195253 )
- Downstream TCR signaling (R-HSA-202424 )
- Regulation of activated PAK-2p34 by proteasome mediated degradation (R-HSA-211733 )
- Separation of Sister Chromatids (R-HSA-2467813 )
- FCERI mediated NF-kB activation (R-HSA-2871837 )
- Autodegradation of the E3 ubiquitin ligase COP1 (R-HSA-349425 )
- Regulation of ornithine decarboxylase (ODC) (R-HSA-350562 )
- ABC-family proteins mediated transport (R-HSA-382556 )
- AUF1 (hnRNP D0) binds and destabilizes mRNA (R-HSA-450408 )
- Asymmetric localization of PCP proteins (R-HSA-4608870 )
- Degradation of AXIN (R-HSA-4641257 )
- Degradation of DVL (R-HSA-4641258 )
- Hedgehog ligand biogenesis (R-HSA-5358346 )
- Hh mutants are degraded by ERAD (R-HSA-5362768 )
- Dectin-1 mediated noncanonical NF-kB signaling (R-HSA-5607761 )
- CLEC7A (Dectin-1) signaling (R-HSA-5607764 )
- Degradation of GLI1 by the proteasome (R-HSA-5610780 )
- Degradation of GLI2 by the proteasome (R-HSA-5610783 )
- GLI3 is processed to GLI3R by the proteasome (R-HSA-5610785 )
- Hedgehog 'on' state (R-HSA-5632684 )
- Regulation of RAS by GAPs (R-HSA-5658442 )
- TNFR2 non-canonical NF-kB pathway (R-HSA-5668541 )
- NIK-->noncanonical NF-kB signaling (R-HSA-5676590 )
- Defective CFTR causes cystic fibrosis (R-HSA-5678895 )
- MAPK6/MAPK4 signaling (R-HSA-5687128 )
- UCH proteinases (R-HSA-5689603 )
- Ub-specific processing proteases (R-HSA-5689880 )
- Assembly of the pre-replicative complex (R-HSA-68867 )
- Orc1 removal from chromatin (R-HSA-68949 )
- CDK-mediated phosphorylation and removal of Cdc6 (R-HSA-69017 )
- G2/M Checkpoints (R-HSA-69481 )
- Ubiquitin Mediated Degradation of Phosphorylated Cdc25A (R-HSA-69601 )
- Ubiquitin-dependent degradation of Cyclin D (R-HSA-75815 )
- The role of GTSE1 in G2/M progression after G2 checkpoint (R-HSA-8852276 )
- FBXL7 down-regulates AURKA during mitotic entry and in early mitosis (R-HSA-8854050 )
- RUNX1 regulates transcription of genes involved in differentiation of HSCs (R-HSA-8939236 )
- Regulation of RUNX2 expression and activity (R-HSA-8939902 )
- Regulation of RUNX3 expression and activity (R-HSA-8941858 )
- Regulation of PTEN stability and activity (R-HSA-8948751 )
- Neddylation (R-HSA-8951664 )
- Regulation of expression of SLITs and ROBOs (R-HSA-9010553 )
- Interleukin-1 signaling (R-HSA-9020702 )
- Negative regulation of NOTCH4 signaling (R-HSA-9604323 )
- KEAP1-NFE2L2 pathway (R-HSA-9755511 )
- GSK3B and BTRC (R-HSA-9762114 )
- Antigen processing (R-HSA-983168 )
- Activation of NF-kappaB in B cells (R-HSA-1169091 )
|
|
|
|
|
|
|
