Details of the Drug Therapeutic Target (DTT)
General Information of Drug Therapeutic Target (DTT) (ID: TTOUZN5)
| DTT Name | Gremlin-1 (Gremlin-1) | ||||
|---|---|---|---|---|---|
| Synonyms |
Proliferation-inducing gene 2; PIG2; Increased in high glucose protein 2; IHG-2; Down-regulated in Mos-transformed cells protein; DRM; DAND2; DAN domain family member 2; Cysteine knot superfamily 1, BMP antagonist 1; Cell proliferation-inducing gene 2 protein; CKTSF1B1
|
||||
| Gene Name | GREM1 | ||||
| DTT Type |
Patented-recorded target
|
[1] | |||
| UniProt ID | |||||
| TTD ID | |||||
| 3D Structure | |||||
| Sequence |
MSRTAYTVGALLLLLGTLLPAAEGKKKGSQGAIPPPDKAQHNDSEQTQSPQQPGSRNRGR
GQGRGTAMPGEEVLESSQEALHVTERKYLKRDWCKTQPLKQTIHEEGCNSRTIINRFCYG QCNSFYIPRHIRKEEGSFQSCSFCKPKKFTTMMVTLNCPELQPPTKKKRVTRVKQCRCIS IDLD |
||||
| Function |
Down-regulates the BMP4 signaling in a dose-dependent manner. Antagonist of BMP2; inhibits BMP2-mediated differentiation of osteoblasts (in vitro). Acts as inhibitor of monocyte chemotaxis. Can inhibit the growth or viability of normal cells but not transformed cells when is overexpressed. Cytokine that may play an important role during carcinogenesis and metanephric kidney organogenesis, as a BMP antagonist required for early limb outgrowth and patterning in maintaining the FGF4-SHH feedback loop.
|
||||
| KEGG Pathway | |||||
Molecular Interaction Atlas (MIA) of This DTT
| Molecular Interaction Atlas (MIA) | ||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
|
1 Patented Agent(s) Targeting This DTT
|
||||||||||||||||||||||||||||