Details of the Drug Therapeutic Target (DTT)
General Information of Drug Therapeutic Target (DTT) (ID: TTOY91U)
| DTT Name | Plasmodium Hypoxanthine-guanine-xanthine phosphoribosyltransferase (Malaria LACZ) | ||||
|---|---|---|---|---|---|
| Synonyms | LACZ of Plasmodium falciparum (isolate K1 / Thailand); HGXPRTase; HGXPRT; HGPRT of Plasmodium falciparum (isolate K1 / Thailand) | ||||
| Gene Name | Malaria LACZ | ||||
| DTT Type |
Literature-reported target
|
[1] | |||
| BioChemical Class |
Pentosyltransferase
|
||||
| UniProt ID | |||||
| TTD ID | |||||
| 3D Structure | |||||
| Sequence |
MPIPNNPGAGENAFDPVFVKDDDGYDLDSFMIPAHYKKYLTKVLVPNGVIKNRIEKLAYD
IKKVYNNEEFHILCLLKGSRGFFTALLKHLSRIHNYSAVEMSKPLFGEHYVRVKSYCNDQ STGTLEIVSEDLSCLKGKHVLIVEDIIDTGKTLVKFCEYLKKFEIKTVAIACLFIKRTPL WNGFKADFVGFSIPDHFVVGYSLDYNEIFRDLDHCCLVNDEGKKKYKATSL |
||||
| Function |
Converts guanine to guanosine monophosphate, and hypoxanthine to inosine monophosphate. Transfers the 5- phosphoribosyl group from 5-phosphoribosylpyrophosphate onto the purine. Works with guanine, hypoxanthine and xanthine. Plays a central role in the generation of purine nucleotides through the purine salvage pathway.
|
||||
Molecular Interaction Atlas (MIA) of This DTT
| Molecular Interaction Atlas (MIA) | ||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
|
1 Investigative Drug(s) Targeting This DTT
|
||||||||||||||||||||||||||||