Details of the Drug Therapeutic Target (DTT)

General Information of Drug Therapeutic Target (DTT) (ID: TTP3IGX)

• DTT Name: Bone morphogenetic protein 2 (BMP2)
• Synonyms: Bone morphogenetic protein 2A; BMP2A; BMP-2A; BMP-2
• Gene Name: BMP2
• DTT Type: Clinical trial target; [1]
• BioChemical Class: Growth factor
• UniProt ID: BMP2_HUMAN
• TTD ID: T68383
• Sequence:
  MVAGTRCLLALLLPQVLLGGAAGLVPELGRRKFAAASSGRPSSQPSDEVLSEFELRLLSM
  FGLKQRPTPSRDAVVPPYMLDLYRRHSGQPGSPAPDHRLERAASRANTVRSFHHEESLEE
  LPETSGKTTRRFFFNLSSIPTEEFITSAELQVFREQMQDALGNNSSFHHRINIYEIIKPA
  TANSKFPVTRLLDTRLVNQNASRWESFDVTPAVMRWTAQGHANHGFVVEVAHLEEKQGVS
  KRHVRISRSLHQDEHSWSQIRPLLVTFGHDGKGHPLHKREKRQAKHKQRKRLKSSCKRHP
  LYVDFSDVGWNDWIVAPPGYHAFYCHGECPFPLADHLNSTNHAIVQTLVNSVNSKIPKAC
  CVPTELSAISMLYLDENEKVVLKNYQDMVVEGCGCR
• Function: Stimulates the differentiation of myoblasts into osteoblasts via the EIF2AK3-EIF2A- ATF4 pathway. BMP2 activation of EIF2AK3 stimulates phosphorylation of EIF2A which leads to increased expression of ATF4 which plays a central role in osteoblast differentiation. In addition stimulates TMEM119, which upregulates the expression of ATF4. Induces cartilage and bone formation.
• KEGG Pathway:
  Cytokine-cytokine receptor interaction (hsa04060)
  Hedgehog signaling pathway (hsa04340)
  TGF-beta signaling pathway (hsa04350)
  Hippo signaling pathway (hsa04390)
  Signaling pathways regulating pluripotency of stem cells (hsa04550)
  Pathways in cancer (hsa05200)
  Basal cell carcinoma (hsa05217)
• Reactome Pathway: Molecules associated with elastic fibres (R-HSA-2129379)

Molecular Interaction Atlas (MIA) of This DTT

1 Clinical Trial Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
DWP-431	DMAFUIR	Bone development disorder	FB86	Phase 3	[1]

References

• [1] Complications with the use of bone morphogenetic protein 2 (BMP-2) in spine surgery. Spine J. 2014 Mar 1;14(3):552-9.