Details of the Drug Therapeutic Target (DTT)

General Information of Drug Therapeutic Target (DTT) (ID: TTP73TM)

• DTT Name: Lymphotoxin-alpha (LTA)
• Synonyms: Tumor necrosis factor ligand superfamily member 1; TNFSF1; TNFB; TNF-beta; LT-alpha
• Gene Name: LTA
• DTT Type: Clinical trial target; [1]
• BioChemical Class: Cytokine: tumor necrosis factor
• UniProt ID: TNFB_HUMAN
• TTD ID: T85158
• Sequence:
  MTPPERLFLPRVCGTTLHLLLLGLLLVLLPGAQGLPGVGLTPSAAQTARQHPKMHLAHST
  LKPAAHLIGDPSKQNSLLWRANTDRAFLQDGFSLSNNSLLVPTSGIYFVYSQVVFSGKAY
  SPKATSSPLYLAHEVQLFSSQYPFHVPLLSSQKMVYPGLQEPWLHSMYHGAAFQLTQGDQ
  LSTHTDGIPHLVLSPSTVFFGAFAL
• Function: In its heterotrimeric form with LTB binds to TNFRSF3/LTBR. Lymphotoxin is produced by lymphocytes and is cytotoxic for a wide range of tumor cells in vitro and in vivo. Cytokine that in its homotrimeric form binds to TNFRSF1A/TNFR1, TNFRSF1B/TNFBR and TNFRSF14/HVEM.
• KEGG Pathway:
  Cytokine-cytokine receptor interaction (hsa04060)
  NF-kappa B signaling pathway (hsa04064)
  TNF signaling pathway (hsa04668)
  Type I diabetes mellitus (hsa04940)
  HTLV-I infection (hsa05166)
  Herpes simplex infection (hsa05168)
• Reactome Pathway:
  TNFs bind their physiological receptors (R-HSA-5669034)
  TNF receptor superfamily (TNFSF) members mediating non-canonical NF-kB pathway (R-HSA-5676594)
  TNFR2 non-canonical NF-kB pathway (R-HSA-5668541)

Molecular Interaction Atlas (MIA) of This DTT

1 Clinical Trial Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
Anti-LT alpha	DMQ58YH	Rheumatoid arthritis	FA20	Phase 2	[1]

Molecular Expression Atlas (MEA) of This DTT

Disease Name	ICD 11	Studied Tissue	p-value	Fold-Change	Z-score
Rheumatoid arthritis	FA20	Synovial tissue	9.54E-03	-0.19	-0.92

References

• [1] Clinical pipeline report, company report or official report of Genentech (2011).