Details of the Drug Therapeutic Target (DTT)

General Information of Drug Therapeutic Target (DTT) (ID: TTPJQHE)

DTT Name	Vascular endothelial growth factor B (VEGFB)
Synonyms	VRF; VEGF-related factor; VEGF-B
Gene Name	VEGFB
DTT Type	Successful target	[1]
BioChemical Class	Growth factor
UniProt ID	VEGFB_HUMAN
TTD ID	T30040
3D Structure	Download 2D Sequence (FASTA) Download 3D Structure (PDB) Download
Sequence	MSPLLRRLLLAALLQLAPAQAPVSQPDAPGHQRKVVSWIDVYTRATCQPREVVVPLTVEL MGTVAKQLVPSCVTVQRCGGCCPDDGLECVPTGQHQVRMQILMIRYPSSQLGEMSLEEHS QCECRPKKKDSAVKPDRAATPHHRPQPRSVPGWDSAPGAPSPADITHPTPAPGPSAHAAP STTSALTPGPAAAAADAAASSVAKGGA
Function	VEGF-B167 binds heparin and neuropilin-1 whereas the binding to neuropilin-1 of VEGF-B186 is regulated by proteolysis. Growth factor for endothelial cells.
KEGG Pathway	Ras signaling pathway (hsa04014 ) Rap1 signaling pathway (hsa04015 ) Cytokine-cytokine receptor interaction (hsa04060 ) PI3K-Akt signaling pathway (hsa04151 ) Focal adhesion (hsa04510 ) Pathways in cancer (hsa05200 )
Reactome Pathway	VEGF ligand-receptor interactions (R-HSA-194313 ) VEGF binds to VEGFR leading to receptor dimerization (R-HSA-195399 ) Platelet degranulation (R-HSA-114608 )

Molecular Interaction Atlas (MIA) of This DTT

Molecular Interaction Atlas (MIA)

Jump to Detail Molecular Interaction Atlas of This DTT

1 Approved Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
Aflibercept	DMT3D5I	Central retinal vein occlusion with macular edema		Approved	[1]
------------------------------------------------------------------------------------

1 Clinical Trial Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
CSL346	DMDWJCT	Diabetic kidney disease	GB61.Z	Phase 2	[2]
------------------------------------------------------------------------------------

Molecular Expression Atlas (MEA) of This DTT

Molecular Expression Atlas (MEA)

Jump to Detail Molecular Expression Atlas of This DTT

Disease Name	ICD 11	Studied Tissue	p-value	Fold-Change	Z-score
Rectal cancer	2C82	Rectal colon tissue	2.75E-01	-0.2	-0.45
------------------------------------------------------------------------------------

References

1	Drugs@FDA. U.S. Food and Drug Administration. U.S. Department of Health & Human Services. 2015
2	ClinicalTrials.gov (NCT04419467) A Phase 2a, Double-blind, Randomized, Placebo-controlled, Proof of Concept Study of Vascular Endothelial Growth Factor (VEGF)-B Blockade With the Monoclonal Antibody CSL346 in Subjects With Diabetic Kidney Disease. U.S.National Institutes of Health.