Details of the Drug Therapeutic Target (DTT)
General Information of Drug Therapeutic Target (DTT) (ID: TTPQE9F)
DTT Name | Early activation antigen CD69 (CD69) | ||||
---|---|---|---|---|---|
Synonyms | MLR3; Leukocyte surface antigen Leu23; GP32/28; Early Tcell activation antigen p60; EA1; Ctype lectin domain family 2 member C; CD69; BLAC/P26; Activation inducer molecule | ||||
Gene Name | CD69 | ||||
DTT Type |
Literature-reported target
|
[1] | |||
UniProt ID | |||||
TTD ID | |||||
3D Structure | |||||
Sequence |
MSSENCFVAENSSLHPESGQENDATSPHFSTRHEGSFQVPVLCAVMNVVFITILIIALIA
LSVGQYNCPGQYTFSMPSDSHVSSCSEDWVGYQRKCYFISTVKRSWTSAQNACSEHGATL AVIDSEKDMNFLKRYAGREEHWVGLKKEPGHPWKWSNGKEFNNWFNVTGSDKCVFLKNTE VSSMECEKNLYWICNKPYK |
||||
Function | Involved in lymphocyte proliferation and functions as a signal transmitting receptor in lymphocytes, natural killer (NK) cells, and platelets. | ||||