Details of the Drug Therapeutic Target (DTT)
General Information of Drug Therapeutic Target (DTT) (ID: TTPR5SX)
| DTT Name | S100 calcium-binding protein A4 (S100A4) | ||||
|---|---|---|---|---|---|
| Synonyms | Protein S100-A4; Protein Mts1; Placental calcium-binding protein; Metastasin; MTS1; Calvasculin; CAPL | ||||
| Gene Name | S100A4 | ||||
| DTT Type |
Literature-reported target
|
[1] | |||
| BioChemical Class |
S100 calcium-binding protein
|
||||
| UniProt ID | |||||
| TTD ID | |||||
| 3D Structure | |||||
| Sequence |
MACPLEKALDVMVSTFHKYSGKEGDKFKLNKSELKELLTRELPSFLGKRTDEAAFQKLMS
NLDSNRDNEVDFQEYCVFLSCIAMMCNEFFEGFPDKQPRKK |
||||
| Function |
collagen-containing extracellular matrix, extracellular exosome, extracellular region, extracellular space, nucleus, perinuclear region of cytoplasm, calcium ion binding, identical protein binding, RAGE receptor binding, RNA binding
|
||||
Molecular Interaction Atlas (MIA) of This DTT
| Molecular Interaction Atlas (MIA) | ||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
|
1 Preclinical Drug(s) Targeting This DTT
|
||||||||||||||||||||||||||||