Details of the Drug Therapeutic Target (DTT)

General Information of Drug Therapeutic Target (DTT) (ID: TTPREZD)

• DTT Name: Interleukin-5 (IL5)
• Synonyms: TRF protein; T-cell replacing factor; IL-5; Eosinophil differentiation factor; B-cell differentiation factor I; B cell differentiation factor I
• Gene Name: IL5
• DTT Type: Successful target; [1]
• BioChemical Class: Cytokine: interleukin
• UniProt ID: IL5_HUMAN
• TTD ID: T78585
• Sequence:
  MRMLLHLSLLALGAAYVYAIPTEIPTSALVKETLALLSTHRTLLIANETLRIPVPVHKNH
  QLCTEEIFQGIGTLESQTVQGGTVERLFKNLSLIKKYIDGQKKKCGEERRRVNQFLDYLQ
  EFLGVMNTEWIIES
• Function: Factor that induces terminal differentiation of late-developing B-cells to immunoglobulin secreting cells.
• KEGG Pathway:
  Cytokine-cytokine receptor interaction (hsa04060)
  Jak-STAT signaling pathway (hsa04630)
  Hematopoietic cell lineage (hsa04640)
  T cell receptor signaling pathway (hsa04660)
  Fc epsilon RI signaling pathway (hsa04664)
  Intestinal immune network for IgA production (hsa04672)
  Asthma (hsa05310)
  Autoimmune thyroid disease (hsa05320)
  Inflammatory bowel disease (IBD) (hsa05321)
  Allograft rejection (hsa05330)
• Reactome Pathway:
  G beta (R-HSA-392451)
  Interleukin-3, 5 and GM-CSF signaling (R-HSA-512988)
  RAF/MAP kinase cascade (R-HSA-5673001)
  Interleukin receptor SHC signaling (R-HSA-912526)
  GPVI-mediated activation cascade (R-HSA-114604)

Molecular Interaction Atlas (MIA) of This DTT

3 Approved Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
Benralizumab	DM7P1J4	Asthma	CA23	Approved	[1]
Mepolizumab	DMW2GEJ	Severe asthma	CA23	Approved	[2]
Reslizumab	DM0AUCH	Severe asthma	CA23	Approved	[3]

2 Clinical Trial Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
Depemokimab	DMG9VHN	Asthma	CA23	Phase 3	[4]
GSK3511294	DMWKSFY	Asthma	CA23	Phase 3	[4]

1 Investigative Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
SOPHORICOSIDE	DM4A0NP	Discovery agent	N.A.	Investigative	[5]

Molecular Expression Atlas (MEA) of This DTT

Disease Name	ICD 11	Studied Tissue	p-value	Fold-Change	Z-score
Chronic obstructive pulmonary disease	CA23	Lung tissue	6.51E-01	-0.02	-0.11
Chronic obstructive pulmonary disease	CA23	Small airway epithelium	1.71E-04	0.12	0.71
Asthma	CA23	Nasal and bronchial airway	4.22E-01	-0.01	-0.04

References

• [1] Benralizumab a humanized mAb to IL-5R with enhanced antibody-dependent cell-mediated cytotoxicity a novel approach for the treatment of asthma
• [2] Mepolizumab: 240563, anti-IL-5 monoclonal antibody - GlaxoSmithKline, anti-interleukin-5 monoclonal antibody - GlaxoSmithKline, SB 240563. Drugs R D. 2008;9(2):125-30.
• [3] The potential of biologics for the treatment of asthma. Nat Rev Drug Discov. 2012 Dec;11(12):958-72.
• [4] A Phase 1 study of the long-acting anti-IL-5 monoclonal antibody GSK3511294 in patients with asthma. Br J Clin Pharmacol. 2022 Feb;88(2):702-712.
• [5] Design and synthesis of novel hydroxyalkylaminomethylchromones for their IL-5 inhibitory activity. Bioorg Med Chem. 2010 Jul 1;18(13):4625-9.