| DTT Name |
HUMAN colony-stimulating factor (GM-CSF)
|
| Synonyms |
Sargramostim; Molgramostin; GM-CSF; Colony-stimulating factor; CSF2; CSF |
| Gene Name |
CSF2
|
| BioChemical Class |
Growth factor
|
| UniProt ID |
|
| TTD ID |
|
| 3D Structure |
|
| Sequence |
MWLQSLLLLGTVACSISAPARSPSPSTQPWEHVNAIQEARRLLNLSRDTAAEMNETVEVI
SEMFDLQEPTCLQTRLELYKQGLRGSLTKLKGPLTMMASHYKQHCPPTPETSCATQIITF
ESFKENLKDFLLVIPFDCWEPVQE
|
| Function |
Cytokine that stimulates the growth and differentiation of hematopoietic precursor cells from various lineages, including granulocytes, macrophages, eosinophils and erythrocytes. |
| KEGG Pathway |
- Cytokine-cytokine receptor interaction (hsa04060 )
- JAK-STAT signaling pathway (hsa04630 )
- Hematopoietic cell lineage (hsa04640 )
- Natural killer cell mediated cytotoxicity (hsa04650 )
- IL-17 signaling pathway (hsa04657 )
- T cell receptor signaling pathway (hsa04660 )
- Fc epsilon RI signaling pathway (hsa04664 )
- TNF signaling pathway (hsa04668 )
- Shigellosis (hsa05131 )
- Amoebiasis (hsa05146 )
- Human T-cell leukemia virus 1 infection (hsa05166 )
- Kaposi sarcoma-associated herpesvirus infection (hsa05167 )
- Coronavirus disease - COVID-19 (hsa05171 )
- Transcriptional misregulation in cancer (hsa05202 )
- Acute myeloid leukemia (hsa05221 )
- Rheumatoid arthritis (hsa05323 )
|
| Reactome Pathway |
- RAF/MAP kinase cascade (R-HSA-5673001 )
- Interleukin-10 signaling (R-HSA-6783783 )
- RUNX1 regulates transcription of genes involved in differentiation of myeloid cells (R-HSA-8939246 )
- Interleukin receptor SHC signaling (R-HSA-912526 )
- Interleukin-3, Interleukin-5 and GM-CSF signaling (R-HSA-512988 )
|
|
|
|
|
|
|
