Details of the Drug Therapeutic Target (DTT)
General Information of Drug Therapeutic Target (DTT) (ID: TTQ79W8)
DTT Name | Apoptosis regulator Bcl-W (BCL-W) | ||||
---|---|---|---|---|---|
Synonyms | KIAA0271; Bcl2-L-2; Bcl-2-like protein 2; BCLW | ||||
Gene Name | BCL2L2 | ||||
DTT Type |
Clinical trial target
|
[1] | |||
BioChemical Class |
B-cell lymphoma Bcl-2
|
||||
UniProt ID | |||||
TTD ID | |||||
3D Structure | |||||
Sequence |
MATPASAPDTRALVADFVGYKLRQKGYVCGAGPGEGPAADPLHQAMRAAGDEFETRFRRT
FSDLAAQLHVTPGSAQQRFTQVSDELFQGGPNWGRLVAFFVFGAALCAESVNKEMEPLVG QVQEWMVAYLETQLADWIHSSGGWAEFTALYGDGALEEARRLREGNWASVRTVLTGAVAL GALVTVGAFFASK |
||||
Function | Blocks dexamethasone-induced apoptosis. Mediates survival of postmitotic Sertoli cells by suppressing death-promoting activity of BAX. Promotes cell survival. | ||||
KEGG Pathway | |||||
Molecular Interaction Atlas (MIA) of This DTT
Molecular Interaction Atlas (MIA) | ||||||||||||||||||||||||||||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
1 Clinical Trial Drug(s) Targeting This DTT
|
||||||||||||||||||||||||||||
1 Patented Agent(s) Targeting This DTT
|
||||||||||||||||||||||||||||