Details of the Drug Therapeutic Target (DTT)

General Information of Drug Therapeutic Target (DTT) (ID: TTQ79W8)

• DTT Name: Apoptosis regulator Bcl-W (BCL-W)
• Synonyms: KIAA0271; Bcl2-L-2; Bcl-2-like protein 2; BCLW
• Gene Name: BCL2L2
• DTT Type: Clinical trial target; [1]
• Related Disease: Myeloproliferative neoplasm [ICD-11: 2A20]
• BioChemical Class: B-cell lymphoma Bcl-2
• UniProt ID: B2CL2_HUMAN
• TTD ID: T03755
• Sequence:
  MATPASAPDTRALVADFVGYKLRQKGYVCGAGPGEGPAADPLHQAMRAAGDEFETRFRRT
  FSDLAAQLHVTPGSAQQRFTQVSDELFQGGPNWGRLVAFFVFGAALCAESVNKEMEPLVG
  QVQEWMVAYLETQLADWIHSSGGWAEFTALYGDGALEEARRLREGNWASVRTVLTGAVAL
  GALVTVGAFFASK
• Function: Blocks dexamethasone-induced apoptosis. Mediates survival of postmitotic Sertoli cells by suppressing death-promoting activity of BAX. Promotes cell survival.

Molecular Interaction Atlas (MIA) of This DTT

1 Clinical Trial Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
ABT-263	DMNE56X	Myelofibrosis	2A20.2	Phase 3	[1], [2], [3]

1 Patented Agent(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
PMID27744724-Compound-18	DM73S2C	N. A.	N. A.	Patented	[4]

Molecular Expression Atlas (MEA) of This DTT

Disease Name	ICD 11	Studied Tissue	p-value	Fold-Change	Z-score
Lung cancer	2C82	Lung tissue	1.83E-48	-0.69	-1.67

References

• [1] Clinical pipeline report, company report or official report of Roche (2009).
• [2] ABT-263 and rapamycin act cooperatively to kill lymphoma cells in vitro and in vivo. Mol Cancer Ther. 2008 Oct;7(10):3265-74.
• [3] ABT-263: a potent and orally bioavailable Bcl-2 family inhibitor. Cancer Res. 2008 May 1;68(9):3421-8.
• [4] Mcl-1 inhibitors: a patent review.Expert Opin Ther Pat. 2017 Feb;27(2):163-178.