Details of the Drug Therapeutic Target (DTT)

General Information of Drug Therapeutic Target (DTT) (ID: TTQA6SX)

DTT Name	Platelet-derived growth factor B (PDGFB)
Synonyms	SIS; Protooncogene cSis; Proto-oncogene c-Sis; Plateletderived growth factor subunit B; Plateletderived growth factor beta polypeptide; Plateletderived growth factor B chain; Platelet-derived growth factor subunit B; Platelet-derived growth factor beta polypeptide; Platelet-derived growth factor B chain; PDGF2; PDGF-2; PDGF subunit B; Becaplermin
Gene Name	PDGFB
DTT Type	Clinical trial target	[1]
BioChemical Class	Growth factor
UniProt ID	PDGFB_HUMAN
TTD ID	T87350
3D Structure	Download 2D Sequence (FASTA) Download 3D Structure (PDB) Download
Sequence	MNRCWALFLSLCCYLRLVSAEGDPIPEELYEMLSDHSIRSFDDLQRLLHGDPGEEDGAEL DLNMTRSHSGGELESLARGRRSLGSLTIAEPAMIAECKTRTEVFEISRRLIDRTNANFLV WPPCVEVQRCSGCCNNRNVQCRPTQVQLRPVQVRKIEIVRKKPIFKKATVTLEDHLACKC ETVAAARPVTRSPGGSQEQRAKTPQTRVTIRTVRVRRPPKGKHRKFKHTHDKTALKETLG A
Function	Potent mitogen for cells of mesenchymal origin. Required for normal proliferation and recruitment of pericytes and vascular smooth muscle cells in the central nervous system, skin, lung, heart and placenta. Required for normal blood vessel development, and for normal development of kidney glomeruli. Plays an important role in wound healing. Signaling is modulated by the formation of heterodimers with PDGFA. Growth factor that plays an essential role in the regulation of embryonic development, cell proliferation, cell migration, survival and chemotaxis.
KEGG Pathway	MAPK signaling pathway (hsa04010 ) Ras signaling pathway (hsa04014 ) Rap1 signaling pathway (hsa04015 ) Cytokine-cytokine receptor interaction (hsa04060 ) PI3K-Akt signaling pathway (hsa04151 ) Focal adhesion (hsa04510 ) Gap junction (hsa04540 ) Regulation of actin cytoskeleton (hsa04810 ) HTLV-I infection (hsa05166 ) Pathways in cancer (hsa05200 ) MicroRNAs in cancer (hsa05206 ) Renal cell carcinoma (hsa05211 ) Glioma (hsa05214 ) Prostate cancer (hsa05215 ) Melanoma (hsa05218 ) Choline metabolism in cancer (hsa05231 )
Reactome Pathway	PIP3 activates AKT signaling (R-HSA-1257604 ) Constitutive Signaling by Aberrant PI3K in Cancer (R-HSA-2219530 ) Non-integrin membrane-ECM interactions (R-HSA-3000171 ) RAF/MAP kinase cascade (R-HSA-5673001 ) Platelet degranulation (R-HSA-114608 )

Molecular Interaction Atlas (MIA) of This DTT

Molecular Interaction Atlas (MIA)

MIA Detail

Jump to Detail Molecular Interaction Atlas of This DTT

4 Clinical Trial Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
PDGF-BB	DMMBC5W	Diabetic foot ulcer	BD54	Phase 3	[1]
E-10030	DMDYWM8	Macular degeneration	9B78.3	Phase 2	[2]
GAM-501	DMAEWS1	Diabetic foot ulcer	BD54	Phase 2	[3]
CR-002	DMKWSFI	Cystic fibrosis	CA25	Phase 1	[4]
------------------------------------------------------------------------------------

References

1	Clinical pipeline report, company report or official report of Adocia.
2	Aptamers as therapeutics. Nat Rev Drug Discov. 2010 Jul;9(7):537-50.
3	Treatment of nonhealing diabetic foot ulcers with a platelet-derived growth factor gene-activated matrix (GAM501): results of a phase 1/2 trial. Wound Repair Regen. 2009 Nov-Dec;17(6):772-9.
4	A phase I study of CR002, a fully-human monoclonal antibody against platelet-derived growth factor-D. Int J Clin Pharmacol Ther. 2008 May;46(5):236-44.