Details of the Drug Therapeutic Target (DTT)
General Information of Drug Therapeutic Target (DTT) (ID: TTQCKWT)
| DTT Name | Activating transcription factor 4 (ATF-4) | ||||
|---|---|---|---|---|---|
| Synonyms |
cAMPresponsive elementbinding protein 2; cAMPdependent transcription factor ATF4; cAMP-responsive element-binding protein 2; cAMP-dependent transcription factor ATF-4; Taxresponsive enhancer elementbinding protein 67; TaxREB67; Tax-responsive enhancer element-binding protein 67; TXREB; DNAbinding protein TAXREB67; DNA-binding protein TAXREB67; Cyclic AMPresponsive elementbinding protein 2; Cyclic AMPdependent transcription factor ATF4; Cyclic AMP-responsive element-binding protein 2; Cyclic AMP-dependent transcription factor ATF-4; CREB2; CREB-2
|
||||
| Gene Name | ATF4 | ||||
| DTT Type |
Literature-reported target
|
[1] | |||
| BioChemical Class |
Basic leucine zipper bZIP
|
||||
| UniProt ID | |||||
| TTD ID | |||||
| 3D Structure | |||||
| Sequence |
MTEMSFLSSEVLVGDLMSPFDQSGLGAEESLGLLDDYLEVAKHFKPHGFSSDKAKAGSSE
WLAVDGLVSPSNNSKEDAFSGTDWMLEKMDLKEFDLDALLGIDDLETMPDDLLTTLDDTC DLFAPLVQETNKQPPQTVNPIGHLPESLTKPDQVAPFTFLQPLPLSPGVLSSTPDHSFSL ELGSEVDITEGDRKPDYTAYVAMIPQCIKEEDTPSDNDSGICMSPESYLGSPQHSPSTRG SPNRSLPSPGVLCGSARPKPYDPPGEKMVAAKVKGEKLDKKLKKMEQNKTAATRYRQKKR AEQEALTGECKELEKKNEALKERADSLAKEIQYLKDLIEEVRKARGKKRVP |
||||
| Function |
Binds the cAMP response element (CRE) (consensus: 5'-GTGACGT[AC][AG]-3'), a sequence present in many viral and cellular promoters. Cooperates with FOXO1 in osteoblasts to regulate glucose homeostasis through suppression of beta-cell production and decrease in insulin production. It binds to a Tax-responsive enhancer element in the long terminal repeat of HTLV-I. Regulates the induction of DDIT3/CHOP and asparagine synthetase (ASNS) in response to endoplasmic reticulum (ER) stress. In concert with DDIT3/CHOP, activates the transcription of TRIB3 and promotes ER stress-induced neuronal apoptosis by regulating the transcriptional induction of BBC3/PUMA. Activates transcription of SIRT4. Regulates the circadian expression of the core clock component PER2 and the serotonin transporter SLC6A4. Binds in a circadian time-dependent manner to the cAMP response elements (CRE) in the SLC6A4 and PER2 promoters and periodically activates the transcription of these genes. During ER stress response, activates the transcription of NLRP1, possibly in concert with other factors. Transcriptional activator.
|
||||
| KEGG Pathway |
|
||||
| Reactome Pathway |
|
||||