Details of the Drug Therapeutic Target (DTT)
General Information of Drug Therapeutic Target (DTT) (ID: TTQD0YT)
DTT Name | Alpha-endosulfine (ENSA) | ||||
---|---|---|---|---|---|
Synonyms | ENSA; ARPP19e | ||||
Gene Name | ENSA | ||||
DTT Type |
Literature-reported target
|
[1] | |||
BioChemical Class |
Endosulfine family
|
||||
UniProt ID | |||||
TTD ID | |||||
3D Structure | |||||
Sequence |
MSQKQEEENPAEETGEEKQDTQEKEGILPERAEEAKLKAKYPSLGQKPGGSDFLMKRLQK
GQKYFDSGDYNMAKAKMKNKQLPSAGPDKNLVTGDHIPTPQDLPQRKSSLVTSKLAGGQV E |
||||
Function | Endogenous ligand for sulfonylurea receptor. By inhibitingsulfonylurea from binding to the receptor, it reduces k(atp) channel currents and thereby stimulates insulin secretion. | ||||
Reactome Pathway | |||||