Details of the Drug Therapeutic Target (DTT)

General Information of Drug Therapeutic Target (DTT) (ID: TTQTX98)

• DTT Name: Interleukin-37 (IL37)
• Synonyms: Interleukin-1-related protein; Interleukin-1 zeta; Interleukin-1 homolog 4; Interleukin-1 family member 7; IL1RP1; IL1H4; IL1F7; IL-37; IL-1X; IL-1RP1; IL-1H4; IL-1H; IL-1F7; IL-1 zeta; FIL1Z; FIL1 zeta
• Gene Name: IL37
• DTT Type: Successful target; [1]
• BioChemical Class: Cytokine: interleukin
• UniProt ID: IL37_HUMAN
• TTD ID: T96845
• Sequence:
  MSFVGENSGVKMGSEDWEKDEPQCCLEDPAGSPLEPGPSLPTMNFVHTSPKVKNLNPKKF
  SIHDQDHKVLVLDSGNLIAVPDKNYIRPEIFFALASSLSSASAEKGSPILLGVSKGEFCL
  YCDKDKGQSHPSLQLKKEKLMKLAAQKESARRPFIFYRAQVGSWNMLESAAHPGWFICTS
  CNCNEPVGVTDKFENRKHIEFSFQPVCKAEMSPSEVSD
• Function: Suppressor of innate inflammatory and immune responses involved in curbing excessive inflammation. This function requires SMAD3. Suppresses, or reduces, proinflammatory cytokine production, including IL1A and IL6, as well as CCL12, CSF1, CSF2, CXCL13, IL1B, IL23A and IL1RN, but spares anti-inflammatory cytokines. Inhibits dendritic cell activation.
• KEGG Pathway:
  Cytokine-cytokine receptor interaction (hsa04060)
  Viral protein interaction with cytokine and cytokine receptor (hsa04061)
• Reactome Pathway:
  Interleukin-18 signaling (R-HSA-9012546)
  Interleukin-37 signaling (R-HSA-9008059)

Molecular Interaction Atlas (MIA) of This DTT

1 Approved Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
Tildrakizumab	DMLW9HG	Plaque psoriasis	EA90.0	Approved	[1]

References

• [1] Clinical pipeline report, company report or official report of the Pharmaceutical Research and Manufacturers of America (PhRMA)