| DTT Name |
HUMAN interferon gamma (IFNG)
|
| Synonyms |
Interferon gamma; Immune interferon; IFN-gamma |
| Gene Name |
IFNG
|
| BioChemical Class |
Cytokine: interferon
|
| UniProt ID |
|
| TTD ID |
|
| 3D Structure |
|
| Sequence |
MKYTSYILAFQLCIVLGSLGCYCQDPYVKEAENLKKYFNAGHSDVADNGTLFLGILKNWK
EESDRKIMQSQIVSFYFKLFKNFKDDQSIQKSVETIKEDMNVKFFNSNKKKRDDFEKLTN
YSVTDLNVQRKAIHELIQVMAELSPAAKTGKRKRSQMLFRGRRASQ
|
| Function |
Produced by lymphocytes activated by specific antigens or mitogens. IFN-gamma, in addition to having antiviral activity, has important immunoregulatory functions. It is a potent activator of macrophages, it has antiproliferative effects on transformed cells and it can potentiate the antiviral and antitumor effects of the type I interferons.
|
| KEGG Pathway |
- Proteasome (hsa03050 )
- Cytokine-cytokine receptor interaction (hsa04060 )
- HIF-1 signaling pathway (hsa04066 )
- Necroptosis (hsa04217 )
- TGF-beta signaling pathway (hsa04350 )
- Osteoclast differentiation (hsa04380 )
- Antigen processing and presentation (hsa04612 )
- JAK-STAT signaling pathway (hsa04630 )
- Natural killer cell mediated cytotoxicity (hsa04650 )
- IL-17 signaling pathway (hsa04657 )
- Th1 and Th2 cell differentiation (hsa04658 )
- Th17 cell differentiation (hsa04659 )
- T cell receptor signaling pathway (hsa04660 )
- Type I diabetes mellitus (hsa04940 )
- Leishmaniasis (hsa05140 )
- Chagas disease (hsa05142 )
- African trypanosomiasis (hsa05143 )
- Malaria (hsa05144 )
- Toxoplasmosis (hsa05145 )
- Amoebiasis (hsa05146 )
- Tuberculosis (hsa05152 )
- Hepatitis C (hsa05160 )
- Influenza A (hsa05164 )
- Herpes simplex virus 1 infection (hsa05168 )
- Pathways in cancer (hsa05200 )
- PD-L1 expression and PD-1 checkpoint pathway in cancer (hsa05235 )
- Inflammatory bowel disease (hsa05321 )
- Systemic lupus erythematosus (hsa05322 )
- Rheumatoid arthritis (hsa05323 )
- Allograft rejection (hsa05330 )
- Graft-versus-host disease (hsa05332 )
- Fluid shear stress and atherosclerosis (hsa05418 )
|
| Reactome Pathway |
- Regulation of IFNG signaling (R-HSA-877312 )
- RUNX1 and FOXP3 control the development of regulatory T lymphocytes (Tregs) (R-HSA-8877330 )
- Gene and protein expression by JAK-STAT signaling after Interleukin-12 stimulation (R-HSA-8950505 )
- Interferon gamma signaling (R-HSA-877300 )
|
|
|
|
|
|
|
