Details of the Drug Therapeutic Target (DTT)
General Information of Drug Therapeutic Target (DTT) (ID: TTRJCNG)
| DTT Name | Glutaredoxin-1 (GLRX) | ||||
|---|---|---|---|---|---|
| Synonyms | Thioltransferase-1; TTase-1; GRX | ||||
| Gene Name | GLRX | ||||
| DTT Type |
Literature-reported target
|
[1] | |||
| UniProt ID | |||||
| TTD ID | |||||
| 3D Structure | |||||
| Sequence |
MAQEFVNCKIQPGKVVVFIKPTCPYCRRAQEILSQLPIKQGLLEFVDITATNHTNEIQDY
LQQLTGARTVPRVFIGKDCIGGCSDLVSLQQSGELLTRLKQIGALQ |
||||
| Function | Has a glutathione-disulfide oxidoreductase activity in the presence of NADPH and glutathione reductase. Reduces low molecular weight disulfides and proteins. | ||||
| Reactome Pathway | |||||
| BioCyc Pathway | |||||