Details of the Drug Therapeutic Target (DTT)

General Information of Drug Therapeutic Target (DTT) (ID: TTRK0B9)

DTT Name	C-type natriuretic peptide (NPPC)
Synonyms	NPPC; Ctype natriuretic peptide; CNP53
Gene Name	NPPC
DTT Type	Clinical trial target	[1]
BioChemical Class	C-type natriuretic peptide
UniProt ID	ANFC_HUMAN
TTD ID	T87689
3D Structure	Download 2D Sequence (FASTA) Download 3D Structure (PDB) Download
Sequence	MHLSQLLACALLLTLLSLRPSEAKPGAPPKVPRTPPAEELAEPQAAGGGQKKGDKAPGGG GANLKGDRSRLLRDLRVDTKSRAAWARLLQEHPNARKYKGANKKGLSKGCFGLKLDRIGS MSGLGC
Function	Hormone which plays a role in endochondral ossification through regulation of cartilaginous growth plate chondrocytes proliferation and differentiation. May also be vasoactive and natriuretic. Specifically binds and stimulates the cGMP production of the NPR2 receptor. Binds the clearance receptor NPR3.
KEGG Pathway	cGMP-PKG signaling pathway (hsa04022 ) Vascular smooth muscle contraction (hsa04270 ) Fluid shear stress and atherosclerosis (hsa05418 )
Reactome Pathway	Physiological factors (R-HSA-5578768 )

Molecular Interaction Atlas (MIA) of This DTT

Molecular Interaction Atlas (MIA)

Jump to Detail Molecular Interaction Atlas of This DTT

1 Approved Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
Vosoritide	DMM9XL2	Achondroplasia	LD24.00	Approved	[1]
------------------------------------------------------------------------------------

References

1	Clinical pipeline report, company report or official report of Biomarin.