Details of the Drug Therapeutic Target (DTT)
General Information of Drug Therapeutic Target (DTT) (ID: TTRV5YJ)
| DTT Name | Hepcidin messenger RNA (HAMP mRNA) | ||||
|---|---|---|---|---|---|
| Synonyms | UNQ487/PRO1003 (mRNA); Putative liver tumor regressor (mRNA); PLTR (mRNA); Liver-expressed antimicrobial peptide 1 (mRNA); LEAP1 (mRNA); LEAP-1 (mRNA); Hepcidin (mRNA); HEPC (mRNA) | ||||
| Gene Name | HAMP | ||||
| DTT Type |
Literature-reported target
|
[1] | |||
| BioChemical Class |
mRNA target
|
||||
| UniProt ID | |||||
| TTD ID | |||||
| 3D Structure | |||||
| Sequence |
MALSSQIWAACLLLLLLLASLTSGSVFPQQTGQLAELQPQDRAGARASWMPMFQRRRRRD
THFPICIFCCGCCHRSKCGMCCKT |
||||
| Function |
Acts by promoting endocytosis and degradation of ferroportin, leading to the retention of iron in iron-exporting cells and decreased flow of iron into plasma. Controls the major flows of iron into plasma: absorption of dietary iron in the intestine, recycling of iron by macrophages, which phagocytose old erythrocytes and other cells, and mobilization of stored iron from hepatocytes. Liver-produced hormone that constitutes the main circulating regulator of iron absorption and distribution across tissues.
|
||||
| KEGG Pathway | |||||