Details of the Drug Therapeutic Target (DTT)
General Information of Drug Therapeutic Target (DTT) (ID: TTS2TGF)
DTT Name | Interferon-omega (IFNW1) | ||||
---|---|---|---|---|---|
Synonyms | Interferon omega1; Interferon omega-1; Interferon alphaII1; Interferon alpha-II-1 | ||||
Gene Name | IFNW1 | ||||
DTT Type |
Clinical trial target
|
[1] | |||
BioChemical Class |
Cytokine: interferon
|
||||
UniProt ID | |||||
TTD ID | |||||
3D Structure | |||||
Sequence |
MALLFPLLAALVMTSYSPVGSLGCDLPQNHGLLSRNTLVLLHQMRRISPFLCLKDRRDFR
FPQEMVKGSQLQKAHVMSVLHEMLQQIFSLFHTERSSAAWNMTLLDQLHTGLHQQLQHLE TCLLQVVGEGESAGAISSPALTLRRYFQGIRVYLKEKKYSDCAWEVVRMEIMKSLFLSTN MQERLRSKDRDLGSS |
||||
Function |
extracellular space, cytokine activity, cytokine receptor binding, type I interferon receptor binding, adaptive immune response, B cell differentiation, B cell proliferation, cell cycle arrest, cytokine-mediated signaling pathway, humoral immune response.
|
||||
KEGG Pathway | |||||
Molecular Interaction Atlas (MIA) of This DTT
Molecular Interaction Atlas (MIA) | ||||||||||||||||||||||||||||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
1 Clinical Trial Drug(s) Targeting This DTT
|
||||||||||||||||||||||||||||