Details of the Drug Therapeutic Target (DTT)
General Information of Drug Therapeutic Target (DTT) (ID: TTS5GLJ)
| DTT Name | B melanoma antigen 1 (BAGE) | ||||
|---|---|---|---|---|---|
| Synonyms | Cancer/testis antigen 2.1; CT2.1; BAGE1; B melanoma antigen; Antigen MZ2BA; Antigen MZ2-BA | ||||
| Gene Name | BAGE | ||||
| DTT Type |
Literature-reported target
|
[1] | |||
| UniProt ID | |||||
| TTD ID | |||||
| 3D Structure | |||||
| Sequence |
MAARAVFLALSAQLLQARLMKEESPVVSWRLEPEDGTALCFIF
|
||||
| Function | Antigen recognized on a melanoma by autologous cytolytic T-lymphocytes. | ||||