Details of the Drug Therapeutic Target (DTT)

General Information of Drug Therapeutic Target (DTT) (ID: TTS78AZ)

DTT Name	Prostate specific antigen (KLK3)
Synonyms	Seminin; Semenogelase; Prostate-specific antigen; PSA; P-30 antigen; Kallikrein-3; Gamma-seminoprotein; APS
Gene Name	KLK3
DTT Type	Clinical trial target	[1]
BioChemical Class	Peptidase
UniProt ID	KLK3_HUMAN
TTD ID	T36935
3D Structure	Download 2D Sequence (FASTA) Download 3D Structure (PDB) Download
EC Number	EC 3.4.21.77
Sequence	MWVPVVFLTLSVTWIGAAPLILSRIVGGWECEKHSQPWQVLVASRGRAVCGGVLVHPQWV LTAAHCIRNKSVILLGRHSLFHPEDTGQVFQVSHSFPHPLYDMSLLKNRFLRPGDDSSHD LMLLRLSEPAELTDAVKVMDLPTQEPALGTTCYASGWGSIEPEEFLTPKKLQCVDLHVIS NDVCAQVHPQKVTKFMLCAGRWTGGKSTCSGDSGGPLVCNGVLQGITSWGSEPCALPERP SLYTKVVHYRKWIKDTIVANP
Function	Hydrolyzes semenogelin-1 thus leading to the liquefaction of the seminal coagulum.
KEGG Pathway	Pathways in cancer (hsa05200 ) Prostate cancer (hsa05215 )
Reactome Pathway	Activated PKN1 stimulates transcription of AR (androgen receptor) regulated genes KLK2 and KLK3 (R-HSA-5625886 ) Regulation of Insulin-like Growth Factor (IGF) transport and uptake by Insulin-like Growth Factor Binding Proteins (IGFBPs) (R-HSA-381426 )

Molecular Interaction Atlas (MIA) of This DTT

Molecular Interaction Atlas (MIA)

Jump to Detail Molecular Interaction Atlas of This DTT

6 Clinical Trial Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
Motexafin lutetium	DM8K5Z6	Artery stenosis	BD52	Phase 3	[1]
ProstaVac	DM5FZH4	Prostate hyperplasia	GA90	Phase 3	[2]
PRX-302	DMEH641	Prostate cancer	2C82.0	Phase 3	[3]
Rilimogene galvacirepvec	DMGTCI0	Prostate cancer	2C82.0	Phase 3	[4]
ADXS-PSA	DMOPVET	Prostate cancer	2C82.0	Phase 1/2	[2]
MVA-BN Breast	DMFMW5C	Prostate cancer	2C82.0	Phase 1	[5]
------------------------------------------------------------------------------------


⏷ Show the Full List of 6 Clinical Trial Drug(s)

4 Investigative Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
Anti-PSA mabs	DMO21T7	Prostate cancer	2C82.0	Investigative	[2]
PMID23692593C20	DM1T9LJ	Discovery agent	N.A.	Investigative	[6]
ProstaRex	DM9GFOM	Prostate cancer	2C82.0	Investigative	[2]
VTT-201	DMT967L	Prostate cancer	2C82.0	Investigative	[2]
------------------------------------------------------------------------------------

Molecular Expression Atlas (MEA) of This DTT

Molecular Expression Atlas (MEA)

Jump to Detail Molecular Expression Atlas of This DTT

Disease Name	ICD 11	Studied Tissue	p-value	Fold-Change	Z-score
Prostate cancer	2C82	Prostate	2.01E-01	-0.04	-0.09
------------------------------------------------------------------------------------

References

1	Motexafin lutetium-photodynamic therapy of prostate cancer: short- and long-term effects on prostate-specific antigen. Clin Cancer Res. 2008 Aug 1;14(15):4869-76.
2	URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Target id: 2373).
3	Phase 1 and 2 studies demonstrate the safety and efficacy of intraprostatic injection of PRX302 for the targeted treatment of lower urinary tract symptoms secondary to benign prostatic hyperplasia. Eur Urol. 2011 May;59(5):747-54.
4	Overall survival analysis of a phase II randomized controlled trial of a Poxviral-based PSA-targeted immunotherapy in metastatic castration-resistant prostate cancer. J Clin Oncol. 2010 Mar 1;28(7):1099-105.
5	Exosome targeting of tumor antigens expressed by cancer vaccines can improve antigen immunogenicity and therapeutic efficacy. Cancer Res. 2011 Aug 1;71(15):5235-44.
6	Structural optimization, biological evaluation, and application of peptidomimetic prostate specific antigen inhibitors. J Med Chem. 2013 Jun 13;56(11):4224-35.