Details of the Drug Therapeutic Target (DTT)

General Information of Drug Therapeutic Target (DTT) (ID: TTS7IR5)

• DTT Name: c-Jun messenger RNA (c-Jun mRNA)
• Synonyms: V-jun avian sarcoma virus 17 oncogene homolog (mRNA); Transcription factor AP-1 (mRNA); Proto-oncogene c-jun (mRNA); P39 (mRNA); C-jun proto-oncogene (mRNA); Activator protein-1 (mRNA); Activator protein 1 (mRNA); AP1 (mRNA); AP-1 transcription factor (mRNA)
• Gene Name: JUN
• DTT Type: Literature-reported target; [1]
• BioChemical Class: mRNA target
• UniProt ID: JUN_HUMAN
• TTD ID: T68227
• Sequence:
  MTAKMETTFYDDALNASFLPSESGPYGYSNPKILKQSMTLNLADPVGSLKPHLRAKNSDL
  LTSPDVGLLKLASPELERLIIQSSNGHITTTPTPTQFLCPKNVTDEQEGFAEGFVRALAE
  LHSQNTLPSVTSAAQPVNGAGMVAPAVASVAGGSGSGGFSASLHSEPPVYANLSNFNPGA
  LSSGGGAPSYGAAGLAFPAQPQQQQQPPHHLPQQMPVQHPRLQALKEEPQTVPEMPGETP
  PLSPIDMESQERIKAERKRMRNRIAASKCRKRKLERIARLEEKVKTLKAQNSELASTANM
  LREQVAQLKQKVMNHVNSGCQLMLTQQLQTF
• Function: Promotes activity of NR5A1 when phosphorylated by HIPK3 leading to increased steroidogenic gene expression upon cAMP signaling pathway stimulation. Involved in activated KRAS-mediated transcriptional activation of USP28 in colorectal cancer (CRC) cells. Binds to the USP28 promoter in colorectal cancer (CRC) cells. Transcription factor that recognizes and binds to the enhancer heptamer motif 5'-TGA[CG]TCA-3'.
• KEGG Pathway:
  MAPK signaling pathway (hsa04010)
  ErbB signaling pathway (hsa04012)
  cAMP signaling pathway (hsa04024)
  Wnt signaling pathway (hsa04310)
  Osteoclast differentiation (hsa04380)
  Focal adhesion (hsa04510)
  Toll-like receptor signaling pathway (hsa04620)
  T cell receptor signaling pathway (hsa04660)
  B cell receptor signaling pathway (hsa04662)
  TNF signaling pathway (hsa04668)
  Neurotrophin signaling pathway (hsa04722)
  GnRH signaling pathway (hsa04912)
  Estrogen signaling pathway (hsa04915)
  Oxytocin signaling pathway (hsa04921)
  Non-alcoholic fatty liver disease (NAFLD) (hsa04932)
  Cocaine addiction (hsa05030)
  Amphetamine addiction (hsa05031)
  Epithelial cell signaling in Helicobacter pylori infection (hsa05120)
  Salmonella infection (hsa05132)
  Pertussis (hsa05133)
  Leishmaniasis (hsa05140)
  Chagas disease (American trypanosomiasis) (hsa05142)
  Hepatitis B (hsa05161)
  Influenza A (hsa05164)
  HTLV-I infection (hsa05166)
  Herpes simplex infection (hsa05168)
  Epstein-Barr virus infection (hsa05169)
  Pathways in cancer (hsa05200)
  Viral carcinogenesis (hsa05203)
  Colorectal cancer (hsa05210)
  Renal cell carcinoma (hsa05211)
  Choline metabolism in cancer (hsa05231)
  Inflammatory bowel disease (IBD) (hsa05321)
  Rheumatoid arthritis (hsa05323)
• Reactome Pathway:
  Oxidative Stress Induced Senescence (R-HSA-2559580)
  Senescence-Associated Secretory Phenotype (SASP) (R-HSA-2559582)
  FCERI mediated MAPK activation (R-HSA-2871796)
  Activation of the AP-1 family of transcription factors (R-HSA-450341)
  MAPK6/MAPK4 signaling (R-HSA-5687128)
  Pre-NOTCH Transcription and Translation (R-HSA-1912408)

Molecular Interaction Atlas (MIA) of This DTT

4 Investigative Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
DCB-3503	DMPRYTW	Discovery agent	N.A.	Investigative	[2]
ISIS 10582	DMB5F9H	Discovery agent	N.A.	Investigative	[1]
Pergularinine	DM8OC9F	Discovery agent	N.A.	Investigative	[2]
[(R)-(+)-deoxytylophorinidine	DMPFUBE	Discovery agent	N.A.	Investigative	[2]

References

• [1] US patent application no. 6,312,900, Antisense oligonucleotide compositions and methods for the modulation of activating protein 1.
• [2] Structure-activity studies of phenanthroindolizidine alkaloids as potential antitumor agents. Bioorg Med Chem Lett. 2007 Aug 1;17(15):4338-42.