Details of the Drug Therapeutic Target (DTT)

General Information of Drug Therapeutic Target (DTT) (ID: TTSINOV)

• DTT Name: Monoacylglycerol lipase ABHD6 (ABHD6)
• Synonyms: Abhydrolase domain-containing protein 6; 2-arachidonoylglycerol hydrolase
• Gene Name: ABHD6
• DTT Type: Patented-recorded target; [1]
• BioChemical Class: Carboxylic ester hydrolase
• UniProt ID: ABHD6_HUMAN
• TTD ID: T81452
• EC Number: EC 3.1.1.23
• Sequence:
  MDLDVVNMFVIAGGTLAIPILAFVASFLLWPSALIRIYYWYWRRTLGMQVRYVHHEDYQF
  CYSFRGRPGHKPSILMLHGFSAHKDMWLSVVKFLPKNLHLVCVDMPGHEGTTRSSLDDLS
  IDGQVKRIHQFVECLKLNKKPFHLVGTSMGGQVAGVYAAYYPSDVSSLCLVCPAGLQYST
  DNQFVQRLKELQGSAAVEKIPLIPSTPEEMSEMLQLCSYVRFKVPQQILQGLVDVRIPHN
  NFYRKLFLEIVSEKSRYSLHQNMDKIKVPTQIIWGKQDQVLDVSGADMLAKSIANCQVEL
  LENCGHSVVMERPRKTAKLIIDFLASVHNTDNNKKLD
• Function: Lipase that preferentially hydrolysis medium-chain saturated monoacylglycerols including 2-arachidonoylglycerol. Through 2-arachidonoylglycerol degradation may regulate endocannabinoid signaling pathways. Also has a lysophosphatidyl lipase activity with a preference for lysophosphatidylglycerol among other lysophospholipids. Also able to degrade bis(monoacylglycero)phosphate (BMP) and constitutes the major enzyme for BMP catabolism. BMP, also known as lysobisphosphatidic acid, is enriched in late endosomes and lysosomes and plays a key role in the formation of intraluminal vesicles and in lipid sorting.
• KEGG Pathway: Retrograde endocannabinoid signaling (hsa04723)
• Reactome Pathway: Arachidonate production from DAG (R-HSA-426048)

Molecular Interaction Atlas (MIA) of This DTT

9 Patented Agent(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
Piperazine carbamic compound 1	DMZSYU4	N. A.	N. A.	Patented	[1]
Piperazine carbamic compound 2	DMMQ0ZO	N. A.	N. A.	Patented	[1]
Piperazine carbamic compound 4	DMKZUO4	N. A.	N. A.	Patented	[1]
Piperazine carbamic compound 5	DMXH65Z	N. A.	N. A.	Patented	[1]
PMID29053063-Compound-11c	DMLMHR5	N. A.	N. A.	Patented	[1]
PMID29053063-Compound-11d	DMDRK68	N. A.	N. A.	Patented	[1]
Pyrazole derivative 80	DMQ3TGM	N. A.	N. A.	Patented	[1]
Pyrazole derivative 81	DMWT437	N. A.	N. A.	Patented	[1]
Pyrazole derivative 82	DMETCI3	N. A.	N. A.	Patented	[1]

References

• [1] A patent review of Monoacylglycerol Lipase (MAGL) inhibitors (2013-2017).Expert Opin Ther Pat. 2017 Dec;27(12):1341-1351.