Details of the Drug Therapeutic Target (DTT)

General Information of Drug Therapeutic Target (DTT) (ID: TTSJVOI)

DTT Name Hepatitis B virus Large envelope protein messenger RNA (HBV S mRNA)
Synonyms L glycoprotein; L-HBsAg; LHB; Large S protein; Large surface protein; Major surface antigen; L glycoprotein; L-HBsAg; LHB; Large S protein; Large surface protein; Major surface antigen
Gene Name HBV S mRNA
DTT Type
Clinical trial target
 [1]
UniProt ID
HBSAG_HBVD3
TTD ID
T52138
Sequence
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPH
GGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTL
QDPRVRGLYFPAGGSSSGTVNPVLTTASPLSSIFSRIGDPALNMENITSGFLGPLLVLQA
GFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCMTTAQGTSMYPSC
CCTKPSDGNCTCIPIPSSWAFGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWM
MWYWGPSLYSILSPFLPLLPIFFCLWVYI
Function
The large envelope protein exists in two topological conformations, one which is termed 'external' or Le-HBsAg and the other 'internal' or Li-HBsAg. In its external conformation the protein attaches the virus to cell receptors and thereby initiating infection. This interaction determines the species specificity and liver tropism. This attachment induces virion internalization predominantly through caveolin-mediated endocytosis. The large envelope protein also assures fusion between virion membrane and endosomal membrane. In its internal conformation the protein plays a role in virion morphogenesis and mediates the contact with the nucleocapsid like a matrix protein.

Molecular Interaction Atlas (MIA) of This DTT

Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DTT
3 Clinical Trial Drug(s) Targeting This DTT
Drug Name Drug ID Indication ICD 11 Highest Status REF
GSK3228836 DMPBK8N Hepatitis B 1E51 Phase 2 [1]
GSK3389404 DMO5JS3 Hepatitis B 1E51 Phase 2 [2]
RG6346 DMOWYKS Hepatitis B virus infection 1E51.0 Phase 1 [3]
------------------------------------------------------------------------------------

References

1 Clinical pipeline report, company report or official report of GlaxoSmithKline.
2 A Randomized, Double-Blind, Placebo-Controlled, First-Time-in-Human Study to Assess the Safety, Tolerability, and Pharmacokinetics of Single and Multiple Ascending Doses of GSK3389404 in Healthy Subjects. Clin Pharmacol Drug Dev. 2019 Aug;8(6):790-801.
3 Clinical pipeline report, company report or official report of Dicerna Pharmaceuticals.