Details of the Drug Therapeutic Target (DTT)

General Information of Drug Therapeutic Target (DTT) (ID: TTST5KX)

• DTT Name: Dickkopf-related protein 2 (DKK2)
• Synonyms: hDkk2; hDkk-2; UNQ682/PRO1316; Dkk2; Dkk-2; Dickkopfrelated protein 2; Dickkopf2; Dickkopf-2
• Gene Name: DKK2
• DTT Type: Literature-reported target; [1]
• BioChemical Class: Dickkopf protein
• UniProt ID: DKK2_HUMAN
• TTD ID: T10125
• Sequence:
  MAALMRSKDSSCCLLLLAAVLMVESSQIGSSRAKLNSIKSSLGGETPGQAANRSAGMYQG
  LAFGGSKKGKNLGQAYPCSSDKECEVGRYCHSPHQGSSACMVCRRKKKRCHRDGMCCPST
  RCNNGICIPVTESILTPHIPALDGTRHRDRNHGHYSNHDLGWQNLGRPHTKMSHIKGHEG
  DPCLRSSDCIEGFCCARHFWTKICKPVLHQGEVCTKQRKKGSHGLEIFQRCDCAKGLSCK
  VWKDATYSSKARLHVCQKI
• Function: DKKs play an important role in vertebrate development, where they locally inhibit Wnt regulated processes such as antero-posterior axial patterning, limb development, somitogenesis and eye formation. In the adult, Dkks are implicated in bone formation and bone disease, cancer and Alzheimer disease. Antagonizes canonical Wnt signaling by inhibiting LRP5/6 interaction with Wnt and by forming a ternary complex with the transmembrane protein KREMEN that promotes internalization of LRP5/6.
• KEGG Pathway:
  Wnt signaling pathway (hsa04310)
  Alzheimer disease (hsa05010)
  Pathways of neurodegeneration - multiple diseases (hsa05022)
• Reactome Pathway:
  Negative regulation of TCF-dependent signaling by WNT ligand antagonists (R-HSA-3772470)
  Signaling by LRP5 mutants (R-HSA-5339717)
  TCF dependent signaling in response to WNT (R-HSA-201681)

References

• [1] Prognostic value of DKK2 from the Dickkopf family in human breast cancer. Int J Oncol. 2018 Dec;53(6):2555-2565.