Details of the Drug Therapeutic Target (DTT)
General Information of Drug Therapeutic Target (DTT) (ID: TTSTVM0)
| DTT Name | High mobility group protein HMGI-C (HMGA2) | ||||
|---|---|---|---|---|---|
| Synonyms | High mobility group AThook protein 2; High mobility group AT-hook protein 2; HMGIC | ||||
| Gene Name | HMGA2 | ||||
| DTT Type |
Literature-reported target
|
[1] | |||
| UniProt ID | |||||
| TTD ID | |||||
| 3D Structure | |||||
| Sequence |
MSARGEGAGQPSTSAQGQPAAPAPQKRGRGRPRKQQQEPTGEPSPKRPRGRPKGSKNKSP
SKAAQKKAEATGEKRPRGRPRKWPQQVVQKKPAQEETEETSSQESAEED |
||||
| Function |
Functions in cell cycle regulation through CCNA2. Plays an important role in chromosome condensation during the meiotic G2/M transition of spermatocytes. Plays a role in postnatal myogenesis, is involved in satellite cell activation. Functions as a transcriptional regulator.
|
||||
| KEGG Pathway | |||||
| Reactome Pathway | |||||