Details of the Drug Therapeutic Target (DTT)
General Information of Drug Therapeutic Target (DTT) (ID: TTTZ3EU)
DTT Name | Valacyclovir hydrolase (BPHL) | ||||
---|---|---|---|---|---|
Synonyms |
VACVase; MCNAA; DJ40E16.6.1; Breast epithelial mucin-associated antigen; Bph-rp; Biphenyl hydrolase-like protein (Serine hydrolase) (Breast epithelial mucin-associated antigen, MCNAA, Bph-rp), variant 1; Biphenyl hydrolase-like protein; BPHL
|
||||
Gene Name | BPHL | ||||
DTT Type |
Literature-reported target
|
[1] | |||
BioChemical Class |
Carboxylic ester hydrolase
|
||||
UniProt ID | |||||
TTD ID | |||||
3D Structure | |||||
EC Number |
EC 3.1.-.-
|
||||
Sequence |
MVAVLGGRGVLRLRLLLSALKPGIHVPRAGPAAAFGTSVTSAKVAVNGVQLHYQQTGEGD
HAVLLLPGMLGSGETDFGPQLKNLNKKLFTVVAWDPRGYGHSRPPDRDFPADFFERDAKD AVDLMKALKFKKVSLLGWSDGGITALIAAAKYPSYIHKMVIWGANAYVTDEDSMIYEGIR DVSKWSERTRKPLEALYGYDYFARTCEKWVDGIRQFKHLPDGNICRHLLPRVQCPALIVH GEKDPLVPRFHADFIHKHVKGSRLHLMPEGKHNLHLRFADEFNKLAEDFLQ |
||||
Function |
Serine hydrolase that catalyzes the hydrolytic activation of amino acid ester prodrugs of nucleoside analogs such as valacyclovir and valganciclovir. Activates valacyclovir to acyclovir. May play a role in detoxification processes. It is a specific alpha-amino acid ester hydrolase that prefers small, hydrophobic, and aromatic side chains and does not have a stringent requirement for the leaving group other than preferring aprimary alcohol.
|
||||
Reactome Pathway | |||||
Molecular Interaction Atlas (MIA) of This DTT
Molecular Interaction Atlas (MIA) | ||||||||||||||||||||||||||||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
1 Investigative Drug(s) Targeting This DTT
|
||||||||||||||||||||||||||||