Details of the Drug Therapeutic Target (DTT)
General Information of Drug Therapeutic Target (DTT) (ID: TTUKRDV)
| DTT Name | T-cell leukemia/lymphoma protein 1A (TCL1A) | ||||
|---|---|---|---|---|---|
| Synonyms | TCL1 oncogene; TCL1; TCL-1 protein; T-cell leukemia/lymphoma 1 oncogene; Protein p14 TCL1; P14 TCL1 protein; Oncogene TCL1; Oncogene TCL-1 | ||||
| Gene Name | TCL1A | ||||
| DTT Type |
Literature-reported target
|
[1] | |||
| UniProt ID | |||||
| TTD ID | |||||
| 3D Structure | |||||
| Sequence |
MAECPTLGEAVTDHPDRLWAWEKFVYLDEKQHAWLPLTIEIKDRLQLRVLLRREDVVLGR
PMTPTQIGPSLLPIMWQLYPDGRYRSSDSSFWRLVYHIKIDGVEDMLLELLPDD |
||||
| Function |
Promotes nuclear translocation of AKT1. Enhances cell proliferation, stabilizes mitochondrial membrane potential and promotes cell survival. Enhances the phosphorylation and activation of AKT1, AKT2 and AKT3.
|
||||
| KEGG Pathway | |||||