Details of the Drug Therapeutic Target (DTT)

General Information of Drug Therapeutic Target (DTT) (ID: TTULOB6)

DTT Name	Cathelicidin antimicrobial peptide (CAMP)
Synonyms	upregulating cAMP; hCAP18; CAP18; CAMP; Antibacterial protein LL37; 18 kDa cationic antimicrobial protein
Gene Name	CAMP
DTT Type	Successful target	[1]
BioChemical Class	Cathelicidin family
UniProt ID	CAMP_HUMAN
TTD ID	T34318
3D Structure	Download 2D Sequence (FASTA) Download 3D Structure (PDB) Download
Sequence	MKTQRDGHSLGRWSLVLLLLGLVMPLAIIAQVLSYKEAVLRAIDGINQRSSDANLYRLLD LDPRPTMDGDPDTPKPVSFTVKETVCPRTTQQSPEDCDFKKDGLVKRCMGTVTLNQARGS FDISCDKDNKRFALLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES
Function	Binds to bacterial lipopolysaccharides (LPS), has antibacterial activity.
KEGG Pathway	Salivary secretion (hsa04970 ) Tuberculosis (hsa05152 )
Reactome Pathway	ROS production in response to bacteria (R-HSA-1222556 )
BioCyc Pathway	MetaCyc:ENSG00000164047-MON

Molecular Interaction Atlas (MIA) of This DTT

Molecular Interaction Atlas (MIA)

Jump to Detail Molecular Interaction Atlas of This DTT

1 Approved Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
Colforsin daropate hci	DMJ01D8	Asthma	CA23	Approved	[1]
------------------------------------------------------------------------------------

Molecular Expression Atlas (MEA) of This DTT

Molecular Expression Atlas (MEA)

Jump to Detail Molecular Expression Atlas of This DTT

Disease Name	ICD 11	Studied Tissue	p-value	Fold-Change	Z-score
Asthma	CA23	Nasal and bronchial airway	7.34E-01	-9.06E-04	-1.65E-03
------------------------------------------------------------------------------------

References

1	Natural products as sources of new drugs over the last 25 years. J Nat Prod. 2007 Mar;70(3):461-77.