Details of the Drug Therapeutic Target (DTT)

General Information of Drug Therapeutic Target (DTT) (ID: TTUQ01B)

• DTT Name: Insulin-like growth factor-binding protein 7 (IGFBP7)
• Synonyms: Tumorderived adhesion factor; Tumor-derived adhesion factor; TAF; Prostacyclinstimulating factor; Prostacyclin-stimulating factor; PSF; PGI2stimulating factor; PGI2-stimulating factor; MAC25 protein; MAC25; Insulinlike growth factorbinding protein 7; IGFbinding protein 7; IGFBPrP1; IGFBP-rP1; IGFBP-7; IGF-binding protein 7; IBP7; IBP-7
• Gene Name: IGFBP7
• DTT Type: Literature-reported target; [1]
• BioChemical Class: Immunoglobulin
• UniProt ID: IBP7_HUMAN
• TTD ID: T69271
• Sequence:
  MERPSLRALLLGAAGLLLLLLPLSSSSSSDTCGPCEPASCPPLPPLGCLLGETRDACGCC
  PMCARGEGEPCGGGGAGRGYCAPGMECVKSRKRRKGKAGAAAGGPGVSGVCVCKSRYPVC
  GSDGTTYPSGCQLRAASQRAESRGEKAITQVSKGTCEQGPSIVTPPKDIWNVTGAQVYLS
  CEVIGIPTPVLIWNKVKRGHYGVQRTELLPGDRDNLAIQTRGGPEKHEVTGWVLVSPLSK
  EDAGEYECHASNSQGQASASAKITVVDALHEIPVKKGEGAEL
• Function: Stimulates prostacyclin (PGI2) production. Stimulates cell adhesion. Binds IGF-I and IGF-II with a relatively low affinity.
• Reactome Pathway:
  Regulation of Insulin-like Growth Factor (IGF) transport and uptake by Insulin-like Growth Factor Binding Proteins (IGFBPs) (R-HSA-381426)
  Post-translational protein phosphorylation (R-HSA-8957275)
  Senescence-Associated Secretory Phenotype (SASP) (R-HSA-2559582)

References

• [1] Insulin growth factor binding protein 7 is a novel target to treat dementia. Neurobiol Dis. 2014 Feb;62:135-43.