Details of the Drug Therapeutic Target (DTT)

General Information of Drug Therapeutic Target (DTT) (ID: TTURHFP)

• DTT Name: Angiogenin (ANG)
• Synonyms: Ribonuclease 5; RNase 5; RNASE5
• Gene Name: ANG
• DTT Type: Literature-reported target; [1]
• BioChemical Class: Endoribonucleases
• UniProt ID: ANGI_HUMAN
• TTD ID: T54229
• EC Number: EC 3.1.27.-
• Sequence:
  MVMGLGVLLLVFVLGLGLTPPTLAQDNSRYTHFLTQHYDAKPQGRDDRYCESIMRRRGLT
  SPCKDINTFIHGNKRSIKAICENKNGNPHRENLRISKSSFQVTTCKLHGGSPWPPCQYRA
  TAGFRNVVVACENGLPVHLDQSIFRRP
• Function: Stimulates ribosomal RNA synthesis including that containing the initiation site sequences of 45S rRNA. Cleaves tRNA within anticodon loops to produce tRNA-derived stress-induced fragments (tiRNAs) which inhibit protein synthesis and triggers the assembly of stress granules (SGs). Angiogenin induces vascularization of normal and malignant tissues. Angiogenic activity is regulated by interaction with RNH1 in vivo. Binds to actin on the surface of endothelial cells; once bound, angiogenin is endocytosed and translocated to the nucleus.
• KEGG Pathway: Amyotrophic lateral sclerosis (hsa05014)
• Reactome Pathway: Adherens junctions interactions (R-HSA-418990)

Molecular Interaction Atlas (MIA) of This DTT

2 Investigative Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
Pyroglutamic Acid	DMROZUA	Discovery agent	N.A.	Investigative	[2]
Pyrophosphate 2-	DMZQ75M	Discovery agent	N.A.	Investigative	[1]

References

• [1] The Protein Data Bank. Nucleic Acids Res. 2000 Jan 1;28(1):235-42.
• [2] How many drug targets are there Nat Rev Drug Discov. 2006 Dec;5(12):993-6.