Details of the Drug Therapeutic Target (DTT)

General Information of Drug Therapeutic Target (DTT) (ID: TTUS18T)

DTT Name	IL-1 receptor-like 2 (IL1RL2)
Synonyms	Interleukin-1 receptor-related protein 2; Interleukin-1 receptor-like 2; IL1RRP2; IL1R-rp2; IL-36R; IL-36 receptor; IL-1Rrp2
Gene Name	IL1RL2
DTT Type	Clinical trial target	[1]
BioChemical Class	Cytokine receptor
UniProt ID	ILRL2_HUMAN
TTD ID	T10988
3D Structure	Download 2D Sequence (FASTA) Download 3D Structure (PDB) Download
Sequence	MWSLLLCGLSIALPLSVTADGCKDIFMKNEILSASQPFAFNCTFPPITSGEVSVTWYKNS SKIPVSKIIQSRIHQDETWILFLPMEWGDSGVYQCVIKGRDSCHRIHVNLTVFEKHWCDT SIGGLPNLSDEYKQILHLGKDDSLTCHLHFPKSCVLGPIKWYKDCNEIKGERFTVLETRL LVSNVSAEDRGNYACQAILTHSGKQYEVLNGITVSITERAGYGGSVPKIIYPKNHSIEVQ LGTTLIVDCNVTDTKDNTNLRCWRVNNTLVDDYYDESKRIREGVETHVSFREHNLYTVNI TFLEVKMEDYGLPFMCHAGVSTAYIILQLPAPDFRAYLIGGLIALVAVAVSVVYIYNIFK IDIVLWYRSAFHSTETIVDGKLYDAYVLYPKPHKESQRHAVDALVLNILPEVLERQCGYK LFIFGRDEFPGQAVANVIDENVKLCRRLIVIVVPESLGFGLLKNLSEEQIAVYSALIQDG MKVILIELEKIEDYTVMPESIQYIKQKHGAIRWHGDFTEQSQCMKTKFWKTVRYHMPPRR CRPFPPVQLLQHTPCYRTAGPELGSRRKKCTLTTG
Function	After binding to interleukin-36 associates with the coreceptor IL1RAP to form the interleukin-36 receptor complex which mediates interleukin-36-dependent activation of NF-kappa-B, MAPK and other pathways. The IL-36 signaling system is thought to be present in epithelial barriers and to take part in local inflammatory response; it is similar to the IL-1 system. Seems to be involved in skin inflammatory response by induction of the IL-23/IL-17/IL-22 pathway. Receptor for interleukin-36 (IL36A, IL36B and IL36G).
KEGG Pathway	Cytokine-cytokine receptor interaction (hsa04060 )
Reactome Pathway	Interleukin-36 pathway (R-HSA-9014826 ) Interleukin-38 signaling (R-HSA-9007892 )

Molecular Interaction Atlas (MIA) of This DTT

Molecular Interaction Atlas (MIA)

MIA Detail

Jump to Detail Molecular Interaction Atlas of This DTT

1 Approved Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
Spesolimab	DM9FZYT	Psoriasis vulgaris	EA90	Approved	[1]
------------------------------------------------------------------------------------

2 Clinical Trial Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
Imsidolimab	DMC3FOW	Generalized pustular psoriasis	EA90.40	Phase 3	[2]
Nemvaleukin alfa	DMOAZHY	Ovarian cancer	2C73	Phase 3	[3]
------------------------------------------------------------------------------------

References

1	Clinical pipeline report, company report or official report of the Pharmaceutical Research and Manufacturers of America (PhRMA)
2	Imsidolimab, an anti-interleukin-36 receptor monoclonal antibody, for the treatment of generalized pustular psoriasis: results from the phase II GALLOP trial. Br J Dermatol. 2023 Jul 17;189(2):161-169.
3	Nemvaleukin alfa, a novel engineered IL-2 fusion protein, drives antitumor immunity and inhibits tumor growth in small cell lung cancer. J Immunother Cancer. 2022 Sep;10(9):e004913.