Details of the Drug Therapeutic Target (DTT)

General Information of Drug Therapeutic Target (DTT) (ID: TTV1C0Z)

• DTT Name: Neuropeptide S receptor (NPSR)
• Synonyms: PGR14; Gprotein coupled receptor for asthma susceptibility; Gprotein coupled receptor PGR14; Gprotein coupled receptor 154; GPRA; GPR154; G-protein coupled receptor for asthma susceptibility; G-protein coupled receptor PGR14; G-protein coupled receptor 154
• Gene Name: NPSR1
• DTT Type: Patented-recorded target; [1]
• BioChemical Class: GPCR rhodopsin
• UniProt ID: NPSR1_HUMAN
• TTD ID: T20958
• Sequence:
  MPANFTEGSFDSSGTGQTLDSSPVACTETVTFTEVVEGKEWGSFYYSFKTEQLITLWVLF
  VFTIVGNSVVLFSTWRRKKKSRMTFFVTQLAITDSFTGLVNILTDINWRFTGDFTAPDLV
  CRVVRYLQVVLLYASTYVLVSLSIDRYHAIVYPMKFLQGEKQARVLIVIAWSLSFLFSIP
  TLIIFGKRTLSNGEVQCWALWPDDSYWTPYMTIVAFLVYFIPLTIISIMYGIVIRTIWIK
  SKTYETVISNCSDGKLCSSYNRGLISKAKIKAIKYSIIIILAFICCWSPYFLFDILDNFN
  LLPDTQERFYASVIIQNLPALNSAINPLIYCVFSSSISFPCREQRSQDSRMTFRERTERH
  EMQILSKPEFI
• Function: Promotes mobilization of intracellular Ca(2+) stores. Inhibits cell growth in response to NPS binding. Involved in pathogenesis of asthma and other IgE-mediated diseases. G-protein coupled receptor for neuropeptide S (NPS).
• KEGG Pathway: Neuroactive ligand-receptor interaction (hsa04080)
• Reactome Pathway:
  G alpha (q) signalling events (R-HSA-416476)
  G alpha (s) signalling events (R-HSA-418555)
  ADORA2B mediated anti-inflammatory cytokines production (R-HSA-9660821)
  Peptide ligand-binding receptors (R-HSA-375276)

Molecular Interaction Atlas (MIA) of This DTT

26 Patented Agent(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
4,5,6,7-tetrahydrofuro[3,4-c]pyridine-1(3H)-one derivative 1	DMCISHW	N. A.	N. A.	Patented	[1]
4,5,6,7-tetrahydrofuro[3,4-c]pyridine-1(3H)-one derivative 2	DMPTRQD	N. A.	N. A.	Patented	[1]
4,5,6,7-tetrahydrofuro[3,4-c]pyridine-1(3H)-one derivative 3	DMFOBM9	N. A.	N. A.	Patented	[1]
4,5,6,7-tetrahydrofuro[3,4-c]pyridine-1(3H)-one derivative 4	DM6MCBU	N. A.	N. A.	Patented	[1]
Imidazo pyridine derivative 4	DM3YMHP	N. A.	N. A.	Patented	[1]
Imidazo pyridine derivative 5	DMOVJ35	N. A.	N. A.	Patented	[1]
Imidazo pyridine derivative 6	DMG6W3O	N. A.	N. A.	Patented	[1]
Indandione derivative 1	DMA6BCH	N. A.	N. A.	Patented	[1]
Indandione derivative 2	DMVR04K	N. A.	N. A.	Patented	[1]
Indandione derivative 3	DM0TURE	N. A.	N. A.	Patented	[1]
Indanone and indandione derivative 1	DMQPTEJ	N. A.	N. A.	Patented	[1]
Oxazolo[3,4-a]pyrazine derivative 1	DMPZ81S	N. A.	N. A.	Patented	[1]
Oxazolo[3,4-a]pyrazine derivative 2	DM28E0A	N. A.	N. A.	Patented	[1]
Oxazolo[3,4-a]pyrazine derivative 3	DM1LPKH	N. A.	N. A.	Patented	[1]
Oxazolo[3,4-a]pyrazine derivative 4	DM1B74D	N. A.	N. A.	Patented	[1]
Oxazolo[3,4-a]pyrazine derivative 5	DMC5G76	N. A.	N. A.	Patented	[1]
Oxazolo[3,4-a]pyrazine derivative 6	DM5DC9A	N. A.	N. A.	Patented	[1]
Oxazolo[3,4-a]pyrazine derivative 7	DMEX5VK	N. A.	N. A.	Patented	[1]
PMID27788040-Compound-5	DMHPK31	N. A.	N. A.	Patented	[1]
PMID27788040-Compound-5a	DMW3X1I	N. A.	N. A.	Patented	[1]
PMID27788040-Compound-5b	DMPQKXR	N. A.	N. A.	Patented	[1]
PMID27788040-Compound-5c	DMK72JS	N. A.	N. A.	Patented	[1]
PMID27788040-Compound-6	DMHX8OF	N. A.	N. A.	Patented	[1]
PMID27788040-Compound-6a	DM4QA6X	N. A.	N. A.	Patented	[1]
PMID27788040-Compound-6b	DMD3U96	N. A.	N. A.	Patented	[1]
PMID27788040-Compound-6c	DMNRU35	N. A.	N. A.	Patented	[1]

3 Investigative Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
PI1	DM68JNY	Discovery agent	N.A.	Investigative	[2]
QA1	DM26GBV	Discovery agent	N.A.	Investigative	[3]
SHA 68	DMW7E32	Discovery agent	N.A.	Investigative	[4]

References

• [1] Neuropeptide S receptor ligands: a patent review (2005-2016).Expert Opin Ther Pat. 2017 Mar;27(3):347-362.
• [2] Tricyclic imidazole antagonists of the Neuropeptide S Receptor. Bioorg Med Chem Lett. 2010 Aug 1;20(15):4704-8.
• [3] Synthesis and evaluation of a new series of Neuropeptide S receptor antagonists. Bioorg Med Chem Lett. 2010 Aug 1;20(15):4700-3.
• [4] Further studies on the pharmacological profile of the neuropeptide S receptor antagonist SHA 68. Peptides. 2010 May;31(5):915-25.